Lus10041915 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025963 57 / 2e-11 ND /
Lus10028460 51 / 2e-09 ND /
Lus10014263 48 / 6e-08 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G114500 65 / 3e-14 ND /
PFAM info
Representative CDS sequence
>Lus10041915 pacid=23146823 polypeptide=Lus10041915 locus=Lus10041915.g ID=Lus10041915.BGIv1.0 annot-version=v1.0
ATGGATACATCATCGCCGCCGCCGTCACCACTGTCACCGAGCCCAAGGAGGAGGAGAACCAACAAAACCGCAATTCTCTGCCTCCCTAGCCTCAGATCAT
CGGAAGGACGCGGTGGCTCAGCCAAGAGCCACCACCGCGTGCCCCCCACGTCCCTTCTAGAACGTTTCCGCGGAGCCGTCTTCCGCCTCATGATGATCTC
CGCTCTTTCCAACTCCTCCTCGTCATCTGTCCCCACCACTCACTCCTCGCCACGTGTCAAGACGAGGGTAAAGAGTAGCAGGCAGCCGCCGCCTTCTGAT
AATTACCACCGCCGCCGCCTTGCTAATCATGAGGATTCTCACCACAGCGAAGCTGTGGCGGATTGCATCGAGTTCATCAAGAAGACATCCGCAGCCGATG
TCCGCAGCCGACGATGA
AA sequence
>Lus10041915 pacid=23146823 polypeptide=Lus10041915 locus=Lus10041915.g ID=Lus10041915.BGIv1.0 annot-version=v1.0
MDTSSPPPSPLSPSPRRRRTNKTAILCLPSLRSSEGRGGSAKSHHRVPPTSLLERFRGAVFRLMMISALSNSSSSSVPTTHSSPRVKTRVKSSRQPPPSD
NYHRRRLANHEDSHHSEAVADCIEFIKKTSAADVRSRR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10041915 0 1
AT3G52970 CYP76G1 "cytochrome P450, family 76, s... Lus10021135 2.0 0.9391
AT2G41810 Protein of unknown function, D... Lus10031067 3.3 0.9265
AT1G51190 AP2_ERF PLT2 PLETHORA 2, Integrase-type DNA... Lus10031260 3.5 0.9363
AT4G12010 Disease resistance protein (TI... Lus10028058 4.6 0.9326
AT1G55210 Disease resistance-responsive ... Lus10017228 6.0 0.9368
AT1G52800 2-oxoglutarate (2OG) and Fe(II... Lus10008097 8.0 0.9313
AT4G25320 AT-hook AT hook motif DNA-binding fami... Lus10031696 8.7 0.9354
AT5G60700 glycosyltransferase family pro... Lus10041317 8.8 0.9335
AT1G79580 NAC ANAC033, SMB, N... NAC (No Apical Meristem) domai... Lus10009939 12.5 0.9137
AT4G12080 AT-hook ATAHL1, AHL1 AT-hook motif nuclear-localize... Lus10002841 16.5 0.9196

Lus10041915 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.