Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21220 130 / 2e-40 SAUR-like auxin-responsive protein family (.1) AT4G34760 126 / 4e-39 SAUR-like auxin-responsive protein family (.1) AT4G38860 124 / 2e-38 SAUR-like auxin-responsive protein family (.1) AT4G36110 118 / 1e-35 SAUR-like auxin-responsive protein family (.1) AT2G18010 115 / 1e-34 SAUR-like auxin-responsive protein family (.1) AT1G75580 114 / 6e-34 SAUR-like auxin-responsive protein family (.1) AT2G16580 113 / 7e-34 SAUR-like auxin-responsive protein family (.1) AT1G19830 104 / 3e-30 SAUR-like auxin-responsive protein family (.1) AT5G66260 90 / 2e-24 SAUR-like auxin-responsive protein family (.1) AT4G34770 89 / 4e-24 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028466 [exp] 164 / 5e-54 AT4G34760 151 / 5e-49 SAUR-like auxin-responsive protein family (.1) Lus10012189 [exp] 126 / 6e-39 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1) Lus10007553 [exp] 124 / 4e-38 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1) Lus10024326 [exp] 120 / 3e-36 AT1G75580 166 / 2e-54 SAUR-like auxin-responsive protein family (.1) Lus10012432 [exp] 118 / 2e-35 AT1G75580 164 / 9e-54 SAUR-like auxin-responsive protein family (.1) Lus10026296 [exp] 110 / 1e-32 AT4G34760 133 / 4e-42 SAUR-like auxin-responsive protein family (.1) Lus10034511 [exp] 103 / 1e-29 AT1G75580 161 / 9e-53 SAUR-like auxin-responsive protein family (.1) Lus10033159 [exp] 102 / 2e-29 AT1G75580 160 / 1e-52 SAUR-like auxin-responsive protein family (.1) Lus10042376 [exp] 92 / 2e-25 AT4G34770 136 / 3e-43 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G012800 [exp] 136 / 5e-43 AT4G34760 164 / 3e-54 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 136 / 7e-43 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.009G126000 [exp] 133 / 8e-42 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1) Potri.005G237200 [exp] 115 / 1e-34 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1) Potri.002G024300 [exp] 114 / 4e-34 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1) Potri.004G166100 [exp] 92 / 1e-25 AT2G21210 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 91 / 8e-25 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.009G127500 [exp] 91 / 9e-25 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 88 / 5e-24 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G165900 [exp] 87 / 1e-23 AT4G34770 99 / 9e-29 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10041921 pacid=23146991 polypeptide=Lus10041921 locus=Lus10041921.g ID=Lus10041921.BGIv1.0 annot-version=v1.0 ATGGCCATATCAAGAAAAGGCAACACCAACAACAACAACAACAACAACAACTCTTATGTTCTGAGGCAAATCCTAAAGAAATGTTCGAGCTTCGGGAAGA GTAGTACTGGCGGCGGTGGTGGGTTACCGGAGGATGTTCCGAAGGGGCACTTTGCGGTGTACGTTGGGGAGAAGAGAAGCAGATACATAGTTCCGATATC GTGGTTGGAGCATCCGGAGTTTCAGAGCTTGCTTGGAAGAGCTGAAGAGGAGTTTGGTTTCAAACACGAGATGGGTCTCACTATTCCTTGTGAAGAAGTT GTTTTCATTTCTTTAACTTCATTGATCAGACGATCTAAAAATAGAGTTTTGTGA
AA sequence Show only first row Show all	>Lus10041921 pacid=23146991 polypeptide=Lus10041921 locus=Lus10041921.g ID=Lus10041921.BGIv1.0 annot-version=v1.0 MAISRKGNTNNNNNNNNSYVLRQILKKCSSFGKSSTGGGGGLPEDVPKGHFAVYVGEKRSRYIVPISWLEHPEFQSLLGRAEEEFGFKHEMGLTIPCEEV VFISLTSLIRRSKNRVL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34760			SAUR-like auxin-responsive pro...		Lus10041921 [exp]	0	1
AT5G49890		ATCLC-C, CLC-C	chloride channel C (.1)		Lus10024466 [exp]	1.0	0.8296
AT5G13640		PDAT1, ATPDAT	PHOSPHOLIPID:DIACYLGLYCEROL AC...		Lus10037657 [exp]	1.4	0.7790
AT5G18610			Protein kinase superfamily pro...		Lus10040350 [exp]	4.9	0.7577
AT5G52210		ATGB1, ATARLB1	GTP-binding protein 1 (.1.2)		Lus10038871 [exp]	4.9	0.7214
AT1G70590			F-box family protein (.1)		Lus10004621 [exp]	11.0	0.7258
AT4G37590		MEL1, NPY5	NAKED PINS IN YUC MUTANTS 5, M...		Lus10019297 [exp]	14.0	0.7068
AT3G18830		ATPMT5, AtPLT5	ARABIDOPSIS THALIANA POLYOL/MO...		Lus10011287 [exp]	16.5	0.6778
AT4G34700		CIB22, AtCIB22	B22 subunit of eukaryotic mito...		Lus10031084 [exp]	21.5	0.7115
AT5G35360		CAC2	acetyl Co-enzyme a carboxylase...		Lus10028753 [exp]	25.1	0.7018
AT1G26920			unknown protein		Lus10012840 [exp]	29.9	0.6861

Compare expression of checked genes

Lus10041921 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.