Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53950 281 / 6e-95 NAC ATCUC2, CUC2, ANAC098 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT3G15170 258 / 1e-86 NAC ATNAC1, CUC1, ANAC054 CUP-SHAPED COTYLEDON1, Arabidopsis NAC domain containing protein 54, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G61430 247 / 3e-82 NAC ANAC100, ATNAC5 NAC domain containing protein 100 (.1) AT5G07680 243 / 1e-80 NAC ANAC079, ATNAC4, ANAC080 Arabidopsis NAC domain containing protein 79, NAC domain containing protein 80 (.1.2) AT5G18270 239 / 5e-79 NAC ANAC087 Arabidopsis NAC domain containing protein 87 (.1.2) AT3G18400 236 / 6e-78 NAC ANAC058 NAC domain containing protein 58 (.1) AT2G24430 234 / 2e-77 NAC ANAC039, ANAC038 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) AT3G29035 234 / 5e-77 NAC ORS1, AtNAC3, ANAC059 ORE1 SISTER1, Arabidopsis NAC domain containing protein 59, NAC domain containing protein 3 (.1) AT5G39610 227 / 5e-75 NAC ORE1, AtNAC2, ANAC092, ATNAC6 ORESARA 1, NAC domain containing protein 2, Arabidopsis NAC domain containing protein 92, NAC domain containing protein 6 (.1) AT3G04060 226 / 9e-74 NAC ANAC046 NAC domain containing protein 46 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005537 [exp] 390 / 1e-138 AT5G53950 317 / 3e-107 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10021659 [exp] 242 / 6e-80 AT5G61430 361 / 8e-125 NAC domain containing protein 100 (.1) Lus10001648 [exp] 242 / 7e-80 AT5G61430 359 / 4e-124 NAC domain containing protein 100 (.1) Lus10009669 [exp] 232 / 5e-76 AT3G18400 308 / 3e-104 NAC domain containing protein 58 (.1) Lus10026879 [exp] 232 / 8e-76 AT5G18270 325 / 3e-110 Arabidopsis NAC domain containing protein 87 (.1.2) Lus10020165 [exp] 233 / 2e-75 AT2G24430 306 / 2e-102 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Lus10009029 [exp] 231 / 2e-75 AT3G18400 311 / 3e-105 NAC domain containing protein 58 (.1) Lus10003435 [exp] 229 / 1e-74 AT5G18270 315 / 2e-106 Arabidopsis NAC domain containing protein 87 (.1.2) Lus10026966 [exp] 228 / 5e-74 AT2G24430 311 / 6e-105 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G115400 [exp] 281 / 3e-95 AT5G53950 312 / 1e-104 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.001G396300 [exp] 272 / 4e-92 AT5G53950 299 / 5e-100 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.012G001400 [exp] 247 / 9e-82 AT5G61430 448 / 1e-158 NAC domain containing protein 100 (.1) Potri.019G031600 [exp] 243 / 1e-79 AT5G18270 328 / 6e-111 Arabidopsis NAC domain containing protein 87 (.1.2) Potri.015G020000 [exp] 240 / 6e-79 AT5G61430 446 / 1e-157 NAC domain containing protein 100 (.1) Potri.013G054200 [exp] 240 / 1e-78 AT5G18270 339 / 4e-115 Arabidopsis NAC domain containing protein 87 (.1.2) Potri.005G255900 [exp] 239 / 4e-78 AT1G76420 295 / 4e-98 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.002G005800 [exp] 239 / 5e-78 AT1G76420 326 / 7e-110 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.012G056300 [exp] 232 / 1e-76 AT3G18400 317 / 6e-108 NAC domain containing protein 58 (.1) Potri.018G003800 [exp] 233 / 2e-76 AT2G24430 350 / 1e-120 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10041924 pacid=23153621 polypeptide=Lus10041924 locus=Lus10041924.g ID=Lus10041924.BGIv1.0 annot-version=v1.0 ATGGATCCACACCCTTTCCACCCTTGCTTCCCATACTCCAACCCTCCTCCATCAACCGACTACACCACCACCGCCAATTTCAACTACACTTCCTCCGCCA ACCACCACCAACAAAACCAAACCACCAACCTCCCACCAGGCTTCAGATTCCACCCGACCGACGAGGAGCTCATAACCTACTACCTCCTCAAAAAGGTCAT GGACTCTTCCTTCTCAGGGCGCGCCATAGCCGAGGTGGACCTCAACAAGTGCGAGCCGTGGCACTTGCCGGAGAAGGCCAAGATGGGGGAGAAAGAGTGG TACTTCTTCTCCCTCCGAGACCGCAAGTACCCGACCGGGCTCCGGACCAACCGAGCCACCGAGGCAGGGTACTGGAAGGCTACGGGGAAAGACAGGGAGA TCTACAGTAGCAAAAGCTGTGCCCTTGTTGGGATGAAGAAGACTCTTGTTTTCTACCGTGGGAGGGCTCCAAAGGGTGAGAAGAGCAATTGGGTCATGCA TGAGTATCGTTTGGAAGGGAAGTTCTCCTACCACTTCCTCTCCCGCTCGTCCAAGGTTAGTACGACGTCGTATTTAAGTTTTACTTGTGAACGTGGAAAT GCATGGTTGTAG
AA sequence Show only first row Show all	>Lus10041924 pacid=23153621 polypeptide=Lus10041924 locus=Lus10041924.g ID=Lus10041924.BGIv1.0 annot-version=v1.0 MDPHPFHPCFPYSNPPPSTDYTTTANFNYTSSANHHQQNQTTNLPPGFRFHPTDEELITYYLLKKVMDSSFSGRAIAEVDLNKCEPWHLPEKAKMGEKEW YFFSLRDRKYPTGLRTNRATEAGYWKATGKDREIYSSKSCALVGMKKTLVFYRGRAPKGEKSNWVMHEYRLEGKFSYHFLSRSSKVSTTSYLSFTCERGN AWL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G53950	NAC	ATCUC2, CUC2, A...	CUP-SHAPED COTYLEDON 2, Arabid...		Lus10041924 [exp]	0	1
AT3G23250	MYB	ATMYB15, ATY19	myb domain protein 15 (.1.2)		Lus10039736 [exp]	2.4	0.9832
AT5G04530		KCS19	3-ketoacyl-CoA synthase 19 (.1...		Lus10023458 [exp]	2.4	0.9883
AT2G42840		PDF1	protodermal factor 1 (.1)		Lus10007351 [exp]	3.7	0.9842
AT3G52610			unknown protein		Lus10014215 [exp]	5.0	0.9818
AT5G61120			unknown protein		Lus10035396 [exp]	5.1	0.9689
AT2G40010			Ribosomal protein L10 family p...		Lus10040214 [exp]	6.0	0.9827
					Lus10006724 [exp]	6.3	0.9767
AT5G04530		KCS19	3-ketoacyl-CoA synthase 19 (.1...		Lus10040333 [exp]	7.1	0.9632
AT1G22590	MADS	AGL87	AGAMOUS-like 87 (.1.2)		Lus10023294 [exp]	7.3	0.9790
AT3G06520			agenet domain-containing prote...		Lus10017088 [exp]	8.0	0.9645

Compare expression of checked genes

Lus10041924 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.