Lus10041927 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G18475 340 / 7e-115 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G09900 171 / 8e-49 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT5G64320 171 / 4e-48 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G09680 167 / 2e-47 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G12300 166 / 5e-47 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G39710 167 / 8e-47 EMB2745 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G22470 166 / 8e-47 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G11690 164 / 2e-46 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G12775 163 / 9e-46 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G05670 163 / 2e-45 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005540 545 / 0 AT5G18475 562 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10027914 177 / 2e-50 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10012068 176 / 9e-50 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027916 171 / 4e-48 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10021074 155 / 1e-44 AT1G62930 273 / 5e-86 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10042452 156 / 3e-44 AT1G53330 442 / 1e-152 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10007468 159 / 5e-44 AT5G01110 808 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10038974 159 / 5e-44 AT1G74580 911 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10006373 158 / 1e-43 AT3G53700 1012 / 0.0 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G103600 390 / 2e-134 AT5G18475 546 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G034400 179 / 7e-52 AT3G22470 476 / 1e-161 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G050180 178 / 2e-51 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050400 177 / 5e-51 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G271400 176 / 8e-51 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.017G131400 176 / 1e-50 AT1G09680 669 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G047400 173 / 3e-50 AT1G63080 341 / 1e-110 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G032600 174 / 4e-50 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050240 171 / 9e-49 AT1G12700 465 / 1e-155 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.016G025600 170 / 3e-48 AT3G22470 426 / 3e-141 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10041927 pacid=23153953 polypeptide=Lus10041927 locus=Lus10041927.g ID=Lus10041927.BGIv1.0 annot-version=v1.0
ATGAGAAAGTCGAGAACTTCGTATCCGAACTTAATCACGTACTCGACTGTCATGGATGGGCTCTGCGAGCAAGGGAGATTCGAAGAAGCGATTGAGTTGT
TCGAGGAGATGGTGTCGAAGGATCAGATCGTACCGGATGCTCTTACTTATAATGTACTGATAAACGGGTTTTGTCGATCAGAGAAAGTCGACCGGGCAAG
GAAGATAATGGAGTTCATGAAGAGCAACGGATGCGCTCCGAATTTGTTTAACTATTCTGCTTTGATGAATGGATTTTGCAGGGAAGGAAAGATGAAAGAG
GCCGAAGAGGTCTTCAAGGAAATGAAGAGTCAAGGGTTTAAGCTTGATGCAGTTGTCTATACAACATTGATAAATTGCCTATGCAGGGGTGGGAGAACTG
ATGATGCCTTAGTATTGCATCAAGAGATGAAGGAAATGGAGTGCAGAGCTGATGTCGTCACGTATAATGTACTGCTACGAGGATTTTCCGAAGAAGGGAG
GTTCGGAGATGCTCTAGCGATGCTCAAGAAGGCAATTAGTGAAGGTGTTTATTTGAACAAAGGGAGTTATAGGATTGTCTTGAACTGCTTATGCAAGACG
GGTGAACTGGAGAAAGCTTCCGAGCTGTTGCGTATGATGCTTGATAGAGGCCATGTCCCGCATTATGCGACTTCGAACGAGCTGTTGGTGAAACTCTGTG
AAGCTGGGAAGGGATATGAAGCTGAGATGACATTAGCAGCCCTGATAGGAACTGGCTTCAAACCGGGAGATGAGTCTTGGACTTGTTTGGTTGAATTGAT
CTGCAGAGAAAGGAAGTTGTTGTCGGCTTTCAAACTGCTTGATGAATTGGCTGGAAATGGTAACCCTTGA
AA sequence
>Lus10041927 pacid=23153953 polypeptide=Lus10041927 locus=Lus10041927.g ID=Lus10041927.BGIv1.0 annot-version=v1.0
MRKSRTSYPNLITYSTVMDGLCEQGRFEEAIELFEEMVSKDQIVPDALTYNVLINGFCRSEKVDRARKIMEFMKSNGCAPNLFNYSALMNGFCREGKMKE
AEEVFKEMKSQGFKLDAVVYTTLINCLCRGGRTDDALVLHQEMKEMECRADVVTYNVLLRGFSEEGRFGDALAMLKKAISEGVYLNKGSYRIVLNCLCKT
GELEKASELLRMMLDRGHVPHYATSNELLVKLCEAGKGYEAEMTLAALIGTGFKPGDESWTCLVELICRERKLLSAFKLLDELAGNGNP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G18475 Pentatricopeptide repeat (PPR)... Lus10041927 0 1
AT3G18510 unknown protein Lus10032475 7.5 0.7869
AT2G30330 BLOS1 BLOC subunit 1, GCN5L1 family ... Lus10030147 14.0 0.7712
AT2G37860 LCD1 LOWER CELL DENSITY 1, Protein ... Lus10024346 16.9 0.7370
AT3G19630 Radical SAM superfamily protei... Lus10020989 18.2 0.7660
AT5G06240 EMB2735 embryo defective 2735 (.1) Lus10021327 20.1 0.7549
AT3G51940 unknown protein Lus10039572 25.9 0.7773
Lus10033670 27.5 0.7099
AT3G06610 DNA-binding enhancer protein-r... Lus10037773 29.6 0.7626
AT1G02290 unknown protein Lus10018907 36.5 0.7403
AT4G08460 Protein of unknown function (D... Lus10024758 40.5 0.7314

Lus10041927 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.