Lus10041930 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G53130 145 / 4e-45 GRI GRIM REAPER, Stigma-specific Stig1 family protein (.1)
AT5G55110 87 / 5e-22 Stigma-specific Stig1 family protein (.1)
AT4G26880 78 / 7e-19 Stigma-specific Stig1 family protein (.1)
AT1G50720 72 / 1e-16 Stigma-specific Stig1 family protein (.1)
AT1G50650 71 / 1e-15 Stigma-specific Stig1 family protein (.1)
AT1G11925 62 / 9e-13 Stigma-specific Stig1 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005544 204 / 5e-69 AT1G53130 125 / 6e-38 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Lus10011146 75 / 2e-17 AT1G50720 125 / 2e-37 Stigma-specific Stig1 family protein (.1)
Lus10043047 75 / 2e-17 AT1G50720 133 / 3e-40 Stigma-specific Stig1 family protein (.1)
Lus10011117 71 / 7e-16 AT1G50720 117 / 6e-34 Stigma-specific Stig1 family protein (.1)
Lus10006512 68 / 6e-15 AT1G50650 71 / 5e-16 Stigma-specific Stig1 family protein (.1)
Lus10000696 65 / 4e-13 AT1G50650 100 / 3e-26 Stigma-specific Stig1 family protein (.1)
Lus10020831 55 / 9e-10 AT1G11925 100 / 7e-28 Stigma-specific Stig1 family protein (.1)
Lus10012679 54 / 2e-09 AT1G11925 104 / 3e-29 Stigma-specific Stig1 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G399200 139 / 5e-43 AT1G53130 149 / 2e-46 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Potri.011G118600 139 / 1e-42 AT1G53130 136 / 1e-41 GRIM REAPER, Stigma-specific Stig1 family protein (.1)
Potri.004G006900 74 / 2e-17 AT1G11925 108 / 4e-31 Stigma-specific Stig1 family protein (.1)
Potri.004G007100 74 / 3e-17 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1)
Potri.011G008932 73 / 9e-17 AT1G11925 91 / 4e-24 Stigma-specific Stig1 family protein (.1)
Potri.001G355700 72 / 2e-16 AT1G50650 119 / 9e-35 Stigma-specific Stig1 family protein (.1)
Potri.011G008804 69 / 2e-15 AT1G11925 98 / 8e-27 Stigma-specific Stig1 family protein (.1)
Potri.011G009000 69 / 2e-15 AT1G11925 98 / 1e-26 Stigma-specific Stig1 family protein (.1)
Potri.011G009100 68 / 5e-15 AT1G11925 125 / 2e-37 Stigma-specific Stig1 family protein (.1)
Potri.011G080800 67 / 1e-14 AT1G50720 130 / 3e-39 Stigma-specific Stig1 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04885 Stig1 Stigma-specific protein, Stig1
Representative CDS sequence
>Lus10041930 pacid=23153737 polypeptide=Lus10041930 locus=Lus10041930.g ID=Lus10041930.BGIv1.0 annot-version=v1.0
ATGGCACCCAACACCAACCTCAGACTCACCATAATCACACTAACAGCCGCCATTCTCCTGATCCTCCAACCAATCTCCTCATCCGCCGCCACATTATTCG
AAGACGATGACGAGTACTACGTCCTCGACAACCCCCCGAAGTCATCATCACGGCCGGGGATGAGCCTGTTCCTCAAGGACAAGATCAGGAAAGGCATGAA
GTGCTACCCCGGAGGAAGCAACATCTGCGACGGAGTTTCGGCTAACAACGGGACAGCAATGCTCTACTGCTGCAAGAACAACTGCAGGAATGTGATCCAG
GACGTCAACAACTGTGGGTCGTGCGGGACCCGGTGCGGGTTCGGGCTACGATGCTGCAATGGTGCCTGCATCAGCGTGGCTTACGATCCTAACCACTGTG
GGGAGTGTAACCAGAAGTGCTCGCCTGGGCAGAAGTGCGAGTATGGTTCGTGCGGCTACGCTTGA
AA sequence
>Lus10041930 pacid=23153737 polypeptide=Lus10041930 locus=Lus10041930.g ID=Lus10041930.BGIv1.0 annot-version=v1.0
MAPNTNLRLTIITLTAAILLILQPISSSAATLFEDDDEYYVLDNPPKSSSRPGMSLFLKDKIRKGMKCYPGGSNICDGVSANNGTAMLYCCKNNCRNVIQ
DVNNCGSCGTRCGFGLRCCNGACISVAYDPNHCGECNQKCSPGQKCEYGSCGYA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G53130 GRI GRIM REAPER, Stigma-specific S... Lus10041930 0 1
AT5G46570 BSK2 BR-signaling kinase 2 (.1) Lus10035136 1.4 0.9078
AT5G60520 Late embryogenesis abundant (L... Lus10015148 15.1 0.8965
AT4G37160 SKS15 SKU5 similar 15 (.1) Lus10019642 18.3 0.9014
AT2G43870 Pectin lyase-like superfamily ... Lus10022530 21.3 0.9011
AT4G31470 CAP (Cysteine-rich secretory p... Lus10011318 27.9 0.8913
AT5G58760 DDB2 damaged DNA binding 2 (.1) Lus10036179 28.2 0.8350
AT5G57500 Galactosyltransferase family p... Lus10006963 32.6 0.8822
AT5G54370 Late embryogenesis abundant (L... Lus10026972 34.1 0.8884
AT5G10130 Pollen Ole e 1 allergen and ex... Lus10041707 35.4 0.8899
AT5G51490 Plant invertase/pectin methyle... Lus10038919 39.2 0.8876

Lus10041930 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.