Lus10041941 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006897 82 / 2e-22 ND /
Lus10041943 81 / 5e-22 ND /
Lus10017954 80 / 1e-21 ND /
Lus10041944 70 / 8e-18 ND /
Lus10017955 67 / 1e-16 ND /
Lus10019472 42 / 1e-06 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G086200 47 / 1e-08 ND /
Potri.012G085901 45 / 4e-08 ND /
Potri.012G085800 46 / 5e-08 ND /
Potri.015G084101 44 / 1e-07 ND /
PFAM info
Representative CDS sequence
>Lus10041941 pacid=23153592 polypeptide=Lus10041941 locus=Lus10041941.g ID=Lus10041941.BGIv1.0 annot-version=v1.0
ATGGACAAGAGCACCCATGGTTACCACACCTACATATCGGCGATGATGAAGGCTCCCAGCATCATGTACGGCGTTCCTCAATACCCGGACGTCCACAAGG
CCTTCAAGCATGATCCGGCTTACTACTATGAACAAGAGCCGAAGCAGAAGCAGCTAGAGCTAGAGCAGCAGCATTTTACAGGATCTGAATTGTGA
AA sequence
>Lus10041941 pacid=23153592 polypeptide=Lus10041941 locus=Lus10041941.g ID=Lus10041941.BGIv1.0 annot-version=v1.0
MDKSTHGYHTYISAMMKAPSIMYGVPQYPDVHKAFKHDPAYYYEQEPKQKQLELEQQHFTGSEL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10041941 0 1
Lus10015488 2.4 0.9106
AT5G24860 ATFPF1, FPF1 ARABIDOPSIS FLOWERING PROMOTIN... Lus10037510 3.7 0.8945
AT4G09900 ATMES12 ARABIDOPSIS THALIANA METHYL ES... Lus10009489 4.6 0.9030
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Lus10025413 5.7 0.8909
AT3G14460 LRR and NB-ARC domains-contain... Lus10039577 6.3 0.8845
AT3G28540 P-loop containing nucleoside t... Lus10007270 8.6 0.9044
AT2G17580 Polynucleotide adenylyltransfe... Lus10035995 9.3 0.7860
AT3G44900 ATCHX4 cation/H+ exchanger 4, cation/... Lus10032621 10.6 0.9026
AT1G14830 DRP1C, ADL5, AD... DYNAMIN RELATED PROTEIN 1C, AR... Lus10043352 12.7 0.8977
AT2G39440 unknown protein Lus10040607 12.8 0.9017

Lus10041941 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.