Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006897 [exp] 87 / 6e-24 ND / Lus10041941 [exp] 81 / 7e-22 ND / Lus10017954 [exp] 81 / 1e-21 ND / Lus10041944 [exp] 70 / 2e-17 ND / Lus10017955 [exp] 67 / 2e-16 ND / Lus10019472 [exp] 48 / 1e-08 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G086200 [exp] 51 / 4e-10 ND / Potri.012G085901 [exp] 50 / 1e-09 ND / Potri.012G085800 [exp] 51 / 2e-09 ND / Potri.015G084101 [exp] 50 / 2e-09 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041943 pacid=23153625 polypeptide=Lus10041943 locus=Lus10041943.g ID=Lus10041943.BGIv1.0 annot-version=v1.0 ATGGACCAGAACACCCATGATTACCACACCTATATATCGGCGATGATGAGGGCTCCCAGCATCATCCACGGCGTTCCTCAATACCCGGACGTCCACAAGG CCTTCAAGCACGATCCGGCTTACTACTACGAACAAGAGCAGAAGCAGAAGCAGCAGCAAGAGCTAGAGCTAGAGCTAGAGCAGCAGCAGCAGAAGAAGAA GAACAGGAAGAAGAACAGGAAGAAGAAGAAGATTTTCGATCTCTGCAAATGA
AA sequence Show only first row Show all	>Lus10041943 pacid=23153625 polypeptide=Lus10041943 locus=Lus10041943.g ID=Lus10041943.BGIv1.0 annot-version=v1.0 MDQNTHDYHTYISAMMRAPSIIHGVPQYPDVHKAFKHDPAYYYEQEQKQKQQQELELELEQQQQKKKNRKKNRKKKKIFDLCK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10041943 [exp]	0	1
AT3G20410		CPK9	calmodulin-domain protein kina...		Lus10032640 [exp]	1.4	0.9452
AT1G67540			unknown protein		Lus10037003 [exp]	2.4	0.8950
AT4G19840		AtPP2A-1, ATPP2...	phloem protein 2-A1 (.1)		Lus10018304 [exp]	3.5	0.9186
AT5G19040		ATIPT5	Arabidopsis thaliana ISOPENTEN...		Lus10004428 [exp]	4.0	0.8994
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10032169 [exp]	5.5	0.9117
AT5G50890			alpha/beta-Hydrolases superfam...		Lus10001506 [exp]	6.3	0.8838
AT3G01470	HD	HD-ZIP-1, HAT5,...	HOMEODOMAIN PROTEIN FROM ARABI...		Lus10036674 [exp]	7.1	0.8982
AT1G18010			Major facilitator superfamily ...		Lus10043371 [exp]	7.5	0.8661
AT4G25650		TIC55-IV, PTC52...	TRANSLOCON AT THE INNER ENVELO...		Lus10025412 [exp]	9.4	0.8807
AT1G75540	CO	LHUS, AtBBX21, ...	long hypocotyl under shade, B-...		Lus10028791 [exp]	9.4	0.8866

Compare expression of checked genes

Lus10041943 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.