Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017955 [exp] 122 / 1e-38 ND / Lus10006897 [exp] 71 / 4e-18 ND / Lus10041941 [exp] 71 / 5e-18 ND / Lus10017954 [exp] 71 / 7e-18 ND / Lus10041943 [exp] 71 / 1e-17 ND / Lus10019472 [exp] 56 / 5e-12 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G085901 [exp] 65 / 9e-16 ND / Potri.012G086200 [exp] 50 / 1e-09 ND / Potri.015G084101 [exp] 49 / 3e-09 ND / Potri.012G085800 [exp] 49 / 4e-09 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041944 pacid=23154033 polypeptide=Lus10041944 locus=Lus10041944.g ID=Lus10041944.BGIv1.0 annot-version=v1.0 ATGGACAGAAGCTCCCATGATTTCCACGCCCACATATCGGCGATGCTGAAGGCTCCCAGCATCATGCACGGCGTACCTCAGTACCCCAACGTCCACAAGG CATTCAAACACGACCCCTACAACACGGAAGGGCAGCAGCAGCAGCAGCAGAAACAGAGGGGTTTCGAGCTCTGCAAATGGAAGAACACTGACGGCTGCCT TGATCAGATGTGA
AA sequence Show only first row Show all	>Lus10041944 pacid=23154033 polypeptide=Lus10041944 locus=Lus10041944.g ID=Lus10041944.BGIv1.0 annot-version=v1.0 MDRSSHDFHAHISAMLKAPSIMHGVPQYPNVHKAFKHDPYNTEGQQQQQQKQRGFELCKWKNTDGCLDQM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10041944 [exp]	0	1
AT3G55740		ATPROT2, ProT2	proline transporter 2 (.1.2)		Lus10040238 [exp]	1.0	0.9510
					Lus10018627 [exp]	3.5	0.9090
					Lus10003879 [exp]	3.6	0.8972
AT5G05365			Heavy metal transport/detoxifi...		Lus10009848 [exp]	3.9	0.9098
AT1G35670		CPK11, ATCDPK2,...	calcium-dependent protein kina...		Lus10014820 [exp]	4.6	0.9086
AT2G30540			Thioredoxin superfamily protei...		Lus10040899 [exp]	5.8	0.9243
					Lus10000650 [exp]	8.5	0.8975
AT5G18970			AWPM-19-like family protein (....		Lus10021949 [exp]	8.8	0.9222
AT5G54160		ATOMT1	O-methyltransferase 1 (.1)		Lus10039864 [exp]	9.6	0.9187
AT3G07880		SCN1	SUPERCENTIPEDE1, Immunoglobuli...		Lus10010491 [exp]	9.8	0.8723

Compare expression of checked genes

Lus10041944 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.