Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G090700 [exp] 44 / 4e-06 AT5G63150 42 / 1e-05 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08213 [flax] [poplar] DUF1713 Mitochondrial domain of unknown function (DUF1713)
Representative CDS sequence Show only first row Show all	>Lus10041954 pacid=23153768 polypeptide=Lus10041954 locus=Lus10041954.g ID=Lus10041954.BGIv1.0 annot-version=v1.0 ATGGCAGCGAATCTAATATCGAAGCTCCTCCGCAGGACTTCGCCGTCATCGGCAACCCTCTCGGCGGCGCTGCACAAAGCTTCTCCGCCCGCTGGACCTA TTTTTTCTCCCCGAGTCCTGCCCGATCTTGCGCCCTGTCCGATCCCGTTCTTTGGCGTCCCGACGCGGGAGAAGGTCTATTACCCTAGTTTCCCGTTTGG GCAGTTGTTAAACCCCATTCCTGCAGGTTTTCTCGATTCGGATGAGATCGAGGTGGATGGGGTTATCGATGATGCTGCTGATAGGACCATGCGAGCTGAC AGCGTGAAAAAGAAGAGGAAGAAGAAGATGAACAAGCACAAGTATAAGAAGCTCCGTAAGCGTCTCAGGCGAAAGTCCAGGTCTTAA
AA sequence Show only first row Show all	>Lus10041954 pacid=23153768 polypeptide=Lus10041954 locus=Lus10041954.g ID=Lus10041954.BGIv1.0 annot-version=v1.0 MAANLISKLLRRTSPSSATLSAALHKASPPAGPIFSPRVLPDLAPCPIPFFGVPTREKVYYPSFPFGQLLNPIPAGFLDSDEIEVDGVIDDAADRTMRAD SVKKKRKKKMNKHKYKKLRKRLRRKSRS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10041954 [exp]	0	1
AT1G43580			Sphingomyelin synthetase famil...		Lus10042814 [exp]	2.0	0.9179
AT4G17720			RNA-binding (RRM/RBD/RNP motif...		Lus10040095 [exp]	4.5	0.9150
AT5G59160		PPO, TOPP2	PROTOPORPHYRINOGEN OXIDASE, ty...		Lus10001555 [exp]	4.6	0.9111
AT1G16300		GAPCP-2	glyceraldehyde-3-phosphate deh...		Lus10000872 [exp]	9.3	0.9262
AT2G44430			DNA-binding bromodomain-contai...		Lus10031796 [exp]	10.5	0.8718
AT5G22280			unknown protein		Lus10043403 [exp]	11.0	0.9058
AT1G74470			Pyridine nucleotide-disulphide...		Lus10008405 [exp]	11.5	0.9050
AT1G04340			HR-like lesion-inducing protei...		Lus10021205 [exp]	12.0	0.9172
AT1G71860		ATPTP1, PTP1	protein tyrosine phosphatase 1...		Lus10028712 [exp]	14.3	0.9121
AT5G13430			Ubiquinol-cytochrome C reducta...		Lus10035118 [exp]	16.4	0.9135

Compare expression of checked genes

Lus10041954 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.