Lus10041974 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017982 98 / 4e-25 AT1G14590 200 / 4e-60 Nucleotide-diphospho-sugar transferase family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10041974 pacid=23153680 polypeptide=Lus10041974 locus=Lus10041974.g ID=Lus10041974.BGIv1.0 annot-version=v1.0
ATGAAAATTCCGGCGGAACCACTGTCGTCGGAAAACGGCGGCGGAGATCAGCGCAGTTGTCGTTTCCTCATGATCATCAGGTCGGAAATCTTGGCCGCCT
TCTTCCTGGGTGTCGTTTTGTGCTGCACCGTCCTCTTCGCCTCCCTCTACGCGTCTTCTGCTTCTTCGCCTGAGTTACTGCTCTCCTTTTCTCCGGCCGG
CCTTCAGAAGTCGTCACCACCGCCGAAGACCAAACAGAAGAGCAATAACACCATCCTCGACGACCCAAAGCTAATAAGAGTACTCCAGAAAGCAACCAAA
ACAGCCACACCACAAGAACTATCATTGATCCTCGGCTACGAAAGAACTCGGTAA
AA sequence
>Lus10041974 pacid=23153680 polypeptide=Lus10041974 locus=Lus10041974.g ID=Lus10041974.BGIv1.0 annot-version=v1.0
MKIPAEPLSSENGGGDQRSCRFLMIIRSEILAAFFLGVVLCCTVLFASLYASSASSPELLLSFSPAGLQKSSPPPKTKQKSNNTILDDPKLIRVLQKATK
TATPQELSLILGYERTR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10041974 0 1
AT2G32235 unknown protein Lus10008093 2.0 0.8558
AT1G76510 ARID ARID/BRIGHT DNA-binding domain... Lus10026569 3.5 0.8470
AT5G55410 Bifunctional inhibitor/lipid-t... Lus10016582 4.0 0.8375
AT5G46490 Disease resistance protein (TI... Lus10042465 8.0 0.8108
AT3G52970 CYP76G1 "cytochrome P450, family 76, s... Lus10021135 13.0 0.8705
Lus10017936 13.7 0.7850
AT1G77260 S-adenosyl-L-methionine-depend... Lus10000973 33.3 0.8279
AT5G09360 LAC14 laccase 14 (.1) Lus10041066 38.4 0.7930
AT1G02205 CER1 ECERIFERUM 1, Fatty acid hydro... Lus10023109 48.8 0.8090
AT5G26650 MADS AGL36 AGAMOUS-like 36 (.1) Lus10016180 51.2 0.7398

Lus10041974 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.