Lus10041975 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G14590 196 / 1e-61 Nucleotide-diphospho-sugar transferase family protein (.1)
AT2G02061 180 / 2e-55 Nucleotide-diphospho-sugar transferase family protein (.1)
AT5G44820 176 / 6e-54 Nucleotide-diphospho-sugar transferase family protein (.1)
AT4G19970 181 / 2e-53 unknown protein
AT4G15970 155 / 5e-46 Nucleotide-diphospho-sugar transferase family protein (.1)
AT1G28700 138 / 1e-39 Nucleotide-diphospho-sugar transferase family protein (.1)
AT1G28695 133 / 9e-38 Nucleotide-diphospho-sugar transferase family protein (.1)
AT1G28710 131 / 2e-37 Nucleotide-diphospho-sugar transferase family protein (.1.2.3)
AT5G40900 101 / 7e-26 Nucleotide-diphospho-sugar transferase family protein (.1)
AT1G70630 52 / 5e-08 Nucleotide-diphospho-sugar transferase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041973 313 / 2e-107 AT1G14590 302 / 3e-100 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10041976 308 / 1e-105 AT1G14590 292 / 4e-96 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10017981 308 / 2e-105 AT1G14590 303 / 9e-101 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10031330 209 / 2e-66 AT2G02061 359 / 4e-122 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10031903 206 / 1e-65 AT2G02061 361 / 1e-122 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10041977 189 / 4e-59 AT1G14590 296 / 9e-98 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10019139 181 / 2e-56 AT1G14590 406 / 8e-142 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10034422 179 / 2e-55 AT1G14590 411 / 2e-143 Nucleotide-diphospho-sugar transferase family protein (.1)
Lus10031927 173 / 4e-54 AT1G14590 386 / 7e-135 Nucleotide-diphospho-sugar transferase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G099400 202 / 9e-64 AT1G14590 490 / 1e-173 Nucleotide-diphospho-sugar transferase family protein (.1)
Potri.008G142200 192 / 1e-60 AT1G14590 454 / 2e-160 Nucleotide-diphospho-sugar transferase family protein (.1)
Potri.015G029200 186 / 4e-58 AT1G14590 405 / 8e-141 Nucleotide-diphospho-sugar transferase family protein (.1)
Potri.012G037300 185 / 8e-58 AT1G14590 404 / 1e-140 Nucleotide-diphospho-sugar transferase family protein (.1)
Potri.012G112600 157 / 6e-47 AT1G28710 306 / 6e-104 Nucleotide-diphospho-sugar transferase family protein (.1.2.3)
Potri.014G051600 150 / 5e-44 AT1G28710 344 / 5e-117 Nucleotide-diphospho-sugar transferase family protein (.1.2.3)
Potri.002G139800 146 / 1e-42 AT1G28710 337 / 1e-114 Nucleotide-diphospho-sugar transferase family protein (.1.2.3)
Potri.015G110600 139 / 4e-40 AT1G28710 300 / 2e-101 Nucleotide-diphospho-sugar transferase family protein (.1.2.3)
Potri.008G186800 46 / 8e-06 AT1G70630 668 / 0.0 Nucleotide-diphospho-sugar transferase family protein (.1)
Potri.002G134400 45 / 1e-05 AT1G19360 622 / 0.0 reduced residual arabinose 3, Nucleotide-diphospho-sugar transferase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0110 GT-A PF03407 Nucleotid_trans Nucleotide-diphospho-sugar transferase
Representative CDS sequence
>Lus10041975 pacid=23153577 polypeptide=Lus10041975 locus=Lus10041975.g ID=Lus10041975.BGIv1.0 annot-version=v1.0
ATGACCCAAGAGTATTTGGTGGTCGTGTGGAGGAAGATTGAGTTGGTTGCATCTGTGTTGCAGCTTGGTTATGACTTGATCCTCACGGATGCTGACATAA
TGTGGTTCAGAAACCCATTCCTACACTTGGCTGCCGAACCGGCAGCCGACATCCAAGTAGCGTGCGATCGTTTCAACGGGAACTCCTCGGATCCCAACAC
CGGGTTCTTCTTTGCCAGATCAAACAACATGACTATCCGATTTTTGAACCATTGGTACGAGTCCAAGGACAGGTATCCAGGAGAGCACGACCAGGACGTA
TTCACCAAAGTCATTCGGTTCGACCGGTTGGTTTCCGACCCAATCGGGATACGTATTTGGTTCCTTGACACGGCTTATTTCGGCGGGTTATGTGAACCAG
TGAAGGACCTCGATTTGGCCATAACAATGCACGCCAACTGCTGCGTGGGGATGGGAGCTAAGGTGCACGATCTCAGGAATGTGCTTTTGGATTGGAAACA
GTACTTATTGTCTGCTGATCCGTCGAGGATCTCGACTCGCTTCGATTGGAAACCGCCACGTTTCGAGTGCAGGGTGCCTGGTGAGTAA
AA sequence
>Lus10041975 pacid=23153577 polypeptide=Lus10041975 locus=Lus10041975.g ID=Lus10041975.BGIv1.0 annot-version=v1.0
MTQEYLVVVWRKIELVASVLQLGYDLILTDADIMWFRNPFLHLAAEPAADIQVACDRFNGNSSDPNTGFFFARSNNMTIRFLNHWYESKDRYPGEHDQDV
FTKVIRFDRLVSDPIGIRIWFLDTAYFGGLCEPVKDLDLAITMHANCCVGMGAKVHDLRNVLLDWKQYLLSADPSRISTRFDWKPPRFECRVPGE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G14590 Nucleotide-diphospho-sugar tra... Lus10041975 0 1
Lus10021703 1.7 0.9400
AT1G68150 WRKY ATWRKY9, WRKY9 WRKY DNA-binding protein 9 (.1... Lus10016682 4.1 0.9476
AT2G03830 RGF8 root meristem growth factor 8,... Lus10036830 5.5 0.9343
AT5G24070 Peroxidase superfamily protein... Lus10025586 6.0 0.9407
AT5G60700 glycosyltransferase family pro... Lus10041317 6.9 0.9343
Lus10036165 7.3 0.9110
AT1G77260 S-adenosyl-L-methionine-depend... Lus10000973 8.1 0.9074
AT5G24070 Peroxidase superfamily protein... Lus10022962 8.4 0.9270
AT1G70560 CKRC1, WEI8, TA... WEAK ETHYLENE INSENSITIVE 8, S... Lus10006199 16.2 0.9200
AT1G43710 EMB1075 embryo defective 1075, Pyridox... Lus10028592 17.4 0.9212

Lus10041975 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.