Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G48540 65 / 2e-14 Outer arm dynein light chain 1 protein (.1.2) AT3G17920 62 / 1e-13 Outer arm dynein light chain 1 protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041988 [exp] 74 / 1e-17 AT3G17920 365 / 1e-111 Outer arm dynein light chain 1 protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G045300 [exp] 79 / 2e-19 AT3G17920 917 / 0.0 Outer arm dynein light chain 1 protein (.1.2) Potri.015G036300 [exp] 68 / 2e-15 AT1G48540 867 / 0.0 Outer arm dynein light chain 1 protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041989 pacid=23153954 polypeptide=Lus10041989 locus=Lus10041989.g ID=Lus10041989.BGIv1.0 annot-version=v1.0 ATGGCGATCGTCACCGGCGATCGCTCCTTTGACAAGCTGGTCACCTTCGTAGAGCAGCACGCCGGCCCTCTGATCGAATCCTCCCTCGTTCTCAAGCTTA ACCCGGCGGGACTCCACTACGTCCACTCCAGGCTCGAGTCCCCCCCTTCCCAACAATAA
AA sequence Show only first row Show all	>Lus10041989 pacid=23153954 polypeptide=Lus10041989 locus=Lus10041989.g ID=Lus10041989.BGIv1.0 annot-version=v1.0 MAIVTGDRSFDKLVTFVEQHAGPLIESSLVLKLNPAGLHYVHSRLESPPSQQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G17920			Outer arm dynein light chain 1...		Lus10041989 [exp]	0	1
AT2G01980		ATSOS1, SOS1, A...	ARABIDOPSIS SALT OVERLY SENSIT...		Lus10038725 [exp]	23.0	0.8042
AT3G54440			glycoside hydrolase family 2 p...		Lus10039520 [exp]	26.6	0.8225
AT5G44150			unknown protein		Lus10005598 [exp]	27.3	0.8012
AT1G70640			octicosapeptide/Phox/Bem1p (PB...		Lus10022759 [exp]	29.6	0.7961
AT5G41790		CIP1	COP1-interactive protein 1 (.1...		Lus10032361 [exp]	30.6	0.7999
AT1G21630			Calcium-binding EF hand family...		Lus10035983 [exp]	32.9	0.8197
AT3G61130		GAUT1, LGT1	galacturonosyltransferase 1 (....		Lus10041389 [exp]	36.3	0.7914
					Lus10013097 [exp]	44.9	0.7995
AT5G47820		FRA1	FRAGILE FIBER 1, P-loop contai...		Lus10010047 [exp]	86.5	0.7641
AT1G69290			Pentatricopeptide repeat (PPR)...		Lus10036907 [exp]	89.8	0.7270

Compare expression of checked genes

Lus10041989 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.