Lus10041993 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18080 103 / 1e-26 BGLU44 B-S glucosidase 44 (.1)
AT3G18070 90 / 1e-21 BGLU43 beta glucosidase 43 (.1.2)
AT2G44480 79 / 5e-18 BGLU17 beta glucosidase 17 (.1.2)
AT2G32860 75 / 2e-16 BGLU33 beta glucosidase 33 (.1.2)
AT2G25630 75 / 2e-16 BGLU14 beta glucosidase 14 (.1)
AT5G44640 75 / 2e-16 BGLU13 beta glucosidase 13 (.1)
AT5G42260 75 / 2e-16 BGLU12 beta glucosidase 12 (.1)
AT2G44450 73 / 1e-15 BGLU15 beta glucosidase 15 (.1)
AT1G61820 71 / 4e-15 BGLU46 beta glucosidase 46 (.1.3)
AT4G21760 70 / 1e-14 BGLU47 beta-glucosidase 47 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009644 105 / 4e-27 AT3G18080 812 / 0.0 B-S glucosidase 44 (.1)
Lus10009013 100 / 5e-26 AT3G18080 516 / 0.0 B-S glucosidase 44 (.1)
Lus10032659 78 / 2e-17 AT4G21760 300 / 2e-97 beta-glucosidase 47 (.1)
Lus10031251 77 / 4e-17 AT2G44450 572 / 0.0 beta glucosidase 15 (.1)
Lus10024941 77 / 5e-17 AT2G44480 602 / 0.0 beta glucosidase 17 (.1.2)
Lus10022883 77 / 6e-17 AT2G44480 599 / 0.0 beta glucosidase 17 (.1.2)
Lus10018353 76 / 2e-16 AT1G61820 629 / 0.0 beta glucosidase 46 (.1.3)
Lus10037473 75 / 3e-16 AT2G44480 590 / 0.0 beta glucosidase 17 (.1.2)
Lus10026657 75 / 3e-16 AT1G26570 856 / 0.0 UDP-glucose dehydrogenase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G049300 106 / 2e-27 AT3G18080 831 / 0.0 B-S glucosidase 44 (.1)
Potri.015G041300 105 / 5e-27 AT3G18080 839 / 0.0 B-S glucosidase 44 (.1)
Potri.001G227300 82 / 9e-19 AT2G44480 585 / 0.0 beta glucosidase 17 (.1.2)
Potri.001G227400 82 / 9e-19 AT2G44480 513 / 3e-180 beta glucosidase 17 (.1.2)
Potri.001G227200 77 / 2e-17 AT2G44480 614 / 0.0 beta glucosidase 17 (.1.2)
Potri.005G059500 72 / 2e-15 AT3G60120 517 / 8e-180 beta glucosidase 27 (.1)
Potri.004G040700 72 / 3e-15 AT5G44640 548 / 0.0 beta glucosidase 13 (.1)
Potri.004G019800 72 / 3e-15 AT4G21760 658 / 0.0 beta-glucosidase 47 (.1)
Potri.T085301 70 / 1e-14 AT5G44640 575 / 0.0 beta glucosidase 13 (.1)
Potri.001G403900 70 / 1e-14 AT4G21760 516 / 7e-180 beta-glucosidase 47 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF00232 Glyco_hydro_1 Glycosyl hydrolase family 1
Representative CDS sequence
>Lus10041993 pacid=23153481 polypeptide=Lus10041993 locus=Lus10041993.g ID=Lus10041993.BGIv1.0 annot-version=v1.0
ATGGCTGACAAGGACGGCCGTGGGCCCAGCATTTGGTACGACTTCATCAACCAACGTCCAGAGCGCAAGGATTACGCCGATTACGCCGATTTCTGCTTCA
AGACATTCAGAGACTGGGTGAAGAACTGGATGACATTCAACGAGCCGAGAGTCACGGCCGCGCTAGGATACGACGACGGCTCATTCGCTCCAGAGGAGTG
CTCCACCAGAAACTGCACAACTGGAGACTCCTCCACCGAGCCTTACATTGCCACCCTATCACTTGATCCTCTCCCACGCCACCGCCGTCCAAAGATGAGA
AGAATGGAGTTCCGGTTGGACCAAGGGAATGAACCGAGCAATGTGACACTTCCAAAGGCATTGCATGACACGGAGAGGATCAAGTACTACAAGGGCTACT
TAGCGCAATTGAAGAAGGCGATTGACGAGACAGAGCCAACGTGA
AA sequence
>Lus10041993 pacid=23153481 polypeptide=Lus10041993 locus=Lus10041993.g ID=Lus10041993.BGIv1.0 annot-version=v1.0
MADKDGRGPSIWYDFINQRPERKDYADYADFCFKTFRDWVKNWMTFNEPRVTAALGYDDGSFAPEECSTRNCTTGDSSTEPYIATLSLDPLPRHRRPKMR
RMEFRLDQGNEPSNVTLPKALHDTERIKYYKGYLAQLKKAIDETEPT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G18080 BGLU44 B-S glucosidase 44 (.1) Lus10041993 0 1
Lus10005828 2.4 0.7702
AT1G79460 ATKS1, ATKS, GA... GA REQUIRING 2, ARABIDOPSIS TH... Lus10034232 2.4 0.7820
AT1G26380 FAD-binding Berberine family p... Lus10021289 5.8 0.7981
AT2G43590 Chitinase family protein (.1) Lus10032794 6.0 0.8070
AT4G03170 B3 AP2/B3-like transcriptional fa... Lus10043234 6.5 0.7208
AT3G09270 ATGSTU8 glutathione S-transferase TAU ... Lus10040763 10.6 0.7423
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10013920 14.8 0.7425
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10014126 15.6 0.7425
AT5G45670 GDSL-like Lipase/Acylhydrolase... Lus10015241 16.2 0.7425
AT5G20260 Exostosin family protein (.1) Lus10039980 16.9 0.7425

Lus10041993 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.