Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G48590 236 / 4e-80 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3) AT3G17980 235 / 1e-79 AtC2 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT5G37740 226 / 2e-76 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) AT1G66360 214 / 2e-71 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT1G73580 211 / 3e-70 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT1G70810 201 / 3e-66 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT2G01540 197 / 1e-64 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT1G70790 191 / 3e-62 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) AT1G70800 189 / 9e-62 EHB1 ENHANCED BENDING 1, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) AT1G23140 181 / 2e-58 Calcium-dependent lipid-binding (CaLB domain) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018005 [exp] 325 / 4e-115 AT3G17980 222 / 1e-74 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10009684 [exp] 262 / 2e-89 AT3G17980 254 / 1e-86 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10009053 [exp] 261 / 7e-89 AT3G17980 255 / 1e-86 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10033585 [exp] 215 / 6e-72 AT3G17980 244 / 1e-83 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10017629 [exp] 211 / 2e-70 AT3G17980 241 / 2e-82 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10021775 [exp] 177 / 8e-57 AT1G70810 209 / 6e-70 Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10001594 [exp] 166 / 7e-52 AT3G17980 187 / 7e-61 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Lus10034591 [exp] 150 / 8e-47 AT1G70790 181 / 3e-59 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) Lus10003710 [exp] 137 / 1e-41 AT1G48590 158 / 2e-50 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2), Calcium-dependent lipid-binding (CaLB domain) family protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G047100 [exp] 242 / 1e-82 AT3G17980 251 / 2e-86 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.017G125500 [exp] 237 / 8e-81 AT3G17980 249 / 6e-86 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.004G089500 [exp] 226 / 1e-76 AT3G17980 245 / 4e-84 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.010G110900 [exp] 207 / 8e-69 AT1G70790 233 / 3e-79 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) Potri.008G131500 [exp] 206 / 3e-68 AT3G17980 202 / 5e-67 Arabidopsis thaliana C2 domain, Calcium-dependent lipid-binding (CaLB domain) family protein (.1) Potri.011G098500 [exp] 138 / 7e-40 AT4G21160 506 / 0.0 ARF-GAP domain 12, Calcium-dependent ARF-type GTPase activating protein family (.1.2.3.4) Potri.006G004600 [exp] 129 / 5e-38 AT5G47710 270 / 3e-94 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) Potri.016G005300 [exp] 128 / 7e-38 AT5G47710 264 / 1e-91 Calcium-dependent lipid-binding (CaLB domain) family protein (.1), Calcium-dependent lipid-binding (CaLB domain) family protein (.2) Potri.001G372000 [exp] 132 / 2e-37 AT4G21160 506 / 0.0 ARF-GAP domain 12, Calcium-dependent ARF-type GTPase activating protein family (.1.2.3.4) Potri.003G198301 [exp] 121 / 2e-32 AT3G07940 503 / 7e-178 Calcium-dependent ARF-type GTPase activating protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0154 [flax] [poplar] C2 PF00168 [flax] [poplar] C2 C2 domain
Representative CDS sequence Show only first row Show all	>Lus10042002 pacid=23153880 polypeptide=Lus10042002 locus=Lus10042002.g ID=Lus10042002.BGIv1.0 annot-version=v1.0 ATGACAGACACACAGTCACCGGCGACGGGGTCGCCGGGGCCGATGGAAGCAAGCCCATCTCCGATAGCGGGGCTGTTAGGGTTGTTGAGGATCCACATCA AACGCGGCGTCAACCTCGCCGTCCGCGACGTTCGCAGCAGCGACCCTTACTGCGTCGTCAAGATGGGCACCCAGAGATTCAAGACCAGCGTTATAAAGAA GGATGTGAATCCAGAGTGGAATGAAGACTTAACTCTATCTGTCACTGATCCTGATCTTCCTGTCAAGTTGACTGTTTATGACTATGACACATTTTCCTTA GACGACAAGATGGGGGATGCGGAGTTCGAAATCAAACCGTTCATGGAAGCGTTGAAGATGGACGTGGTAGGCCTCCCTGACGGGACCATACTCAACAAGA TACAGCCGAGCAGGGCCAACTGCCTGGCCGAGGAGACGTGCATTGTGTGCGAGGAAGGCAAAGTTATTCAAGACATGATCCTCAGATTGAGGAACGTCGA ATGCGGTGAGGTTGAGCTCCAGTTGCGGTGGATTGATCTCCACGGTCTCGGTCATGGTCACGATCACCACAGCGTTTAA
AA sequence Show only first row Show all	>Lus10042002 pacid=23153880 polypeptide=Lus10042002 locus=Lus10042002.g ID=Lus10042002.BGIv1.0 annot-version=v1.0 MTDTQSPATGSPGPMEASPSPIAGLLGLLRIHIKRGVNLAVRDVRSSDPYCVVKMGTQRFKTSVIKKDVNPEWNEDLTLSVTDPDLPVKLTVYDYDTFSL DDKMGDAEFEIKPFMEALKMDVVGLPDGTILNKIQPSRANCLAEETCIVCEEGKVIQDMILRLRNVECGEVELQLRWIDLHGLGHGHDHHSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G48590			Calcium-dependent lipid-bindin...		Lus10042002 [exp]	0	1
AT1G70530		CRK3	cysteine-rich RLK (RECEPTOR-li...		Lus10013040 [exp]	11.8	0.8438
AT3G25900		HMT-1, ATHMT-1	Homocysteine S-methyltransfera...		Lus10041451 [exp]	13.1	0.8534
AT2G38060		PHT4;2	phosphate transporter 4;2 (.1)		Lus10035532 [exp]	14.9	0.8725
AT3G29200		ATCM1, CM1	ARABIDOPSIS THALIANA CHORISMAT...		Lus10032998 [exp]	15.2	0.8502
AT1G32100		ATPRR1	pinoresinol reductase 1 (.1)		Lus10010403 [exp]	19.4	0.8560
AT3G22060			Receptor-like protein kinase-r...		Lus10039698 [exp]	20.1	0.8067
AT1G15880		ATGOS11, GOS11	golgi snare 11 (.1)		Lus10026058 [exp]	20.4	0.8294
AT1G18265			Protein of unknown function, D...		Lus10020457 [exp]	22.3	0.8261
AT5G35960			Protein kinase family protein ...		Lus10027964 [exp]	27.0	0.7814
AT3G19895			RING/U-box superfamily protein...		Lus10000199 [exp]	27.6	0.7940

Compare expression of checked genes

Lus10042002 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.