Lus10042009 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G18200 267 / 3e-91 AtRABA6b RAB GTPase homolog A6B (.1)
AT1G73640 264 / 8e-90 AtRABA6a RAB GTPase homolog A6A (.1)
AT5G59150 226 / 4e-75 ATRAB-A2D, AtRABA2d ARABIDOPSIS RAB GTPASE HOMOLOG A2D, RAB GTPase homolog A2D (.1)
AT5G45750 225 / 1e-74 AtRABA1c RAB GTPase homolog A1C (.1)
AT3G46830 225 / 1e-74 ATRAB-A2C, AtRab11A, AtRABA2c ARABIDOPSIS RAB GTPASE HOMOLOG A2C, RAB GTPase homolog A2C (.1)
AT1G16920 224 / 2e-74 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1)
AT1G07410 223 / 4e-74 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
AT5G60860 221 / 3e-73 AtRABA1f RAB GTPase homolog A1F (.1)
AT4G18800 220 / 9e-73 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1)
AT1G09630 220 / 1e-72 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018013 381 / 1e-135 AT1G18200 275 / 9e-94 RAB GTPase homolog A6B (.1)
Lus10029253 228 / 8e-76 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1)
Lus10007306 227 / 2e-75 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1)
Lus10025432 221 / 3e-73 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1)
Lus10013961 221 / 3e-73 AT5G60860 412 / 7e-149 RAB GTPase homolog A1F (.1)
Lus10040745 221 / 3e-73 AT1G07410 394 / 7e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Lus10016486 221 / 3e-73 AT1G07410 396 / 1e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Lus10015297 221 / 7e-73 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1)
Lus10002178 220 / 1e-72 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G039700 277 / 4e-95 AT1G73640 331 / 2e-116 RAB GTPase homolog A6A (.1)
Potri.011G070300 227 / 1e-75 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1)
Potri.004G061000 226 / 4e-75 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1)
Potri.016G000400 222 / 2e-73 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.001G374000 222 / 2e-73 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1)
Potri.019G092500 221 / 2e-73 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Potri.006G000300 221 / 4e-73 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.010G197200 221 / 5e-73 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Potri.003G004100 219 / 2e-72 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Potri.011G061300 218 / 5e-72 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00071 Ras Ras family
Representative CDS sequence
>Lus10042009 pacid=23153530 polypeptide=Lus10042009 locus=Lus10042009.g ID=Lus10042009.BGIv1.0 annot-version=v1.0
ATGGCGGCGGTGACGGTGGACGGGTACGGAGACGAGGAGGAGGAGCAAGAGTGTGACTACCTGTTCAAGGCGGTGATGATCGGCGACTCGGCCGTGGGGA
AGACGAACCTGCTGTCGAGATTCTCGAGGAACGAGTTCCGAGTCGACTCTAAGCCGACGATCGGCGTGGAGTTCGCTTACAGAGATGTCAAAGTCGGGAA
CAAGCTCATCAAAGCTCAAATCTGGGACACCGCCGGCCAAGAAAGGTTCAGAGCAATAACGAGCTCGTACTATAGGGGAGCCTTGGGTGCACTAGTGGTG
TACGACATTTCCCGGCGGGGGACGTTCCACAACGTCGAGAAATGGCTCGACGAGCTCCGTGGCTTCAGCAACTCCGATATGGTAGTCGTCCTCGTTGGCA
ACAAGTCCGACGCGGCCCGCCACCTCCGCGAGGTCAGCGAGGAGGACGGCCGGAGTCTCGCGGAAGCGGAAGGGATCTCCTTCATGGAGACCTCCGCCAG
GGACGGGGTCAACGTCGACGCTGCTTTCCTTGAGATGATAGCCAAGATCCACCTCCGGAACACCTCCCACCGCTCATTAGACGGCGGCAGCGGCAGAGGG
AGGAATTCCTCTGCCGCCGTTGCTCCGGGGGCGCCGCTTCCCCCAGGGGGCACCTCCGGAACACCTCCCACCGCTCATTAG
AA sequence
>Lus10042009 pacid=23153530 polypeptide=Lus10042009 locus=Lus10042009.g ID=Lus10042009.BGIv1.0 annot-version=v1.0
MAAVTVDGYGDEEEEQECDYLFKAVMIGDSAVGKTNLLSRFSRNEFRVDSKPTIGVEFAYRDVKVGNKLIKAQIWDTAGQERFRAITSSYYRGALGALVV
YDISRRGTFHNVEKWLDELRGFSNSDMVVVLVGNKSDAARHLREVSEEDGRSLAEAEGISFMETSARDGVNVDAAFLEMIAKIHLRNTSHRSLDGGSGRG
RNSSAAVAPGAPLPPGGTSGTPPTAH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G18200 AtRABA6b RAB GTPase homolog A6B (.1) Lus10042009 0 1
AT5G01360 TBL3 TRICHOME BIREFRINGENCE-LIKE 3,... Lus10027813 1.0 0.9827
AT4G35020 ROP6, ARAC3, RH... RHO-RELATED PROTEIN FROM PLANT... Lus10039899 1.4 0.9826
AT2G38080 ATLMCO4, IRX12,... LACCASE 4, IRREGULAR XYLEM 12,... Lus10041481 1.7 0.9740
AT3G13130 unknown protein Lus10004415 5.3 0.9626
AT1G68200 C3HZnF Zinc finger C-x8-C-x5-C-x3-H t... Lus10034624 5.7 0.9687
Lus10026494 6.5 0.9574
Lus10024940 6.9 0.9454
AT3G46440 UXS5 UDP-XYL synthase 5 (.1.2) Lus10005900 7.1 0.9653
AT2G14740 VSR2;2, BP80-2;... VACUOLAR SORTING RECEPTOR 3, V... Lus10002130 9.5 0.9600
AT4G35300 TMT2 tonoplast monosaccharide trans... Lus10013208 10.4 0.9437

Lus10042009 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.