Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018014 [exp] 125 / 2e-39 ND / Lus10018015 [exp] 100 / 4e-29 ND / Lus10042011 [exp] 93 / 1e-26 ND / Lus10031026 [exp] 71 / 7e-18 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G044300 [exp] 71 / 4e-18 ND / Potri.016G041301 [exp] 57 / 1e-12 ND / Potri.006G044200 [exp] 47 / 2e-08 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042010 pacid=23153489 polypeptide=Lus10042010 locus=Lus10042010.g ID=Lus10042010.BGIv1.0 annot-version=v1.0 ATGGCCGGTCTTCAATACAACTTCTTCCCAACCGACTTCTACTACCCTCGCCCCGCGTCCGTCGCCGGAGCTGCCGAACCCGCCAAGAAATTGTCCCTCC CTATGCAGGTCCAGAAGCGATCAGACGTTGATAGCCAACACGACGTGATCAGTCACCCCGCCAGACTGGTCCTCCACAACAAGGCCAACAAGTCCGCCGG CGCCATCGCCGCCGTGGAGAACAAGAGGAGGAAGTGA
AA sequence Show only first row Show all	>Lus10042010 pacid=23153489 polypeptide=Lus10042010 locus=Lus10042010.g ID=Lus10042010.BGIv1.0 annot-version=v1.0 MAGLQYNFFPTDFYYPRPASVAGAAEPAKKLSLPMQVQKRSDVDSQHDVISHPARLVLHNKANKSAGAIAAVENKRRK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10042010 [exp]	0	1
AT1G19910		AVA-2PE, ATVHA-...	VACUOLAR-TYPE H+ ATPASE C2, AT...		Lus10010623 [exp]	3.5	0.8527
AT1G26800			RING/U-box superfamily protein...		Lus10030464 [exp]	8.8	0.8287
AT1G79870			D-isomer specific 2-hydroxyaci...		Lus10025796 [exp]	9.3	0.8504
AT1G76920			F-box family protein (.1)		Lus10018896 [exp]	10.2	0.8413
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10040958 [exp]	11.8	0.8456
AT4G19950			unknown protein		Lus10038358 [exp]	13.0	0.8385
AT2G39050		ArathEULS3	Euonymus lectin S3, hydroxypro...		Lus10006551 [exp]	13.8	0.8295
AT5G11260	bZIP	TED5, HY5	REVERSAL OF THE DET PHENOTYPE ...		Lus10002028 [exp]	14.5	0.8252
AT4G29680			Alkaline-phosphatase-like fami...		Lus10032681 [exp]	19.9	0.8466
AT5G64430			Octicosapeptide/Phox/Bem1p fam...		Lus10010752 [exp]	20.1	0.8309

Compare expression of checked genes

Lus10042010 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.