Lus10042011 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018015 154 / 5e-51 ND /
Lus10042010 93 / 2e-26 ND /
Lus10018014 81 / 1e-21 ND /
Lus10031026 66 / 9e-16 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G041301 62 / 3e-14 ND /
Potri.006G044300 61 / 7e-14 ND /
Potri.006G044200 47 / 2e-08 ND /
PFAM info
Representative CDS sequence
>Lus10042011 pacid=23153588 polypeptide=Lus10042011 locus=Lus10042011.g ID=Lus10042011.BGIv1.0 annot-version=v1.0
ATGGCCGGTCTGCAGTACAACTTCTTCCCAACCGACTTCTTCTATCCTCGCCCCACGTCCGTCGCCGGAGCAGCAGAATCGGCCGCCCAGAAATCGTCCC
TTCCTCTGCAGGTCCAGAAGTGGCCACACGTCGATCACCACCGCGATGTGAATCACCCCACCGGTTTAGTCCTCCGTACCACCACCAACAAGTTAGTCCC
CGCCGTAGAGAATAAGAGGAAGAAGAAATACCATCACCTGGATGGGTAA
AA sequence
>Lus10042011 pacid=23153588 polypeptide=Lus10042011 locus=Lus10042011.g ID=Lus10042011.BGIv1.0 annot-version=v1.0
MAGLQYNFFPTDFFYPRPTSVAGAAESAAQKSSLPLQVQKWPHVDHHRDVNHPTGLVLRTTTNKLVPAVENKRKKKYHHLDG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10042011 0 1
AT5G06920 FLA21 FASCICLIN-like arabinogalactan... Lus10019675 1.4 0.9540
Lus10036557 1.7 0.9523
AT1G61800 ATGPT2, GPT2 ARABIDOPSIS GLUCOSE-6-PHOSPHAT... Lus10007653 2.2 0.9421
AT1G49000 unknown protein Lus10032453 2.4 0.9403
AT1G62740 Hop2 Hop2, stress-inducible protein... Lus10004336 3.0 0.9545
AT3G11690 unknown protein Lus10021243 4.7 0.9209
AT5G64510 TIN1 tunicamycin induced 1, unknown... Lus10020502 5.9 0.9392
AT5G02500 AtHsp70-1, AT-H... HEAT SHOCK PROTEIN 70-1, ARABI... Lus10023418 7.2 0.9504
AT1G68620 alpha/beta-Hydrolases superfam... Lus10041473 7.5 0.9143
Lus10041371 7.5 0.8988

Lus10042011 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.