Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74670 96 / 5e-27 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT5G15230 83 / 1e-21 GASA4 GAST1 protein homolog 4 (.1.2) AT3G10185 79 / 2e-20 Gibberellin-regulated family protein (.1) AT2G30810 78 / 7e-20 Gibberellin-regulated family protein (.1) AT2G39540 76 / 4e-19 Gibberellin-regulated family protein (.1) AT3G02885 71 / 3e-17 GASA5 GAST1 protein homolog 5 (.1) AT1G10588 71 / 5e-17 Gibberellin-regulated family protein (.1.2) AT5G59845 68 / 6e-16 Gibberellin-regulated family protein (.1) AT1G22690 61 / 6e-13 Gibberellin-regulated family protein (.1.2.3) AT2G14900 58 / 4e-12 Gibberellin-regulated family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018016 [exp] 206 / 5e-70 AT1G74670 110 / 2e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10042203 [exp] 94 / 5e-26 AT1G74670 138 / 6e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10029340 [exp] 94 / 5e-26 AT2G30810 108 / 3e-32 Gibberellin-regulated family protein (.1) Lus10024216 [exp] 95 / 6e-26 AT1G74670 106 / 1e-30 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10008612 [exp] 94 / 7e-26 AT1G74670 138 / 8e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10002059 [exp] 92 / 3e-25 AT1G74670 132 / 1e-41 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10004048 [exp] 91 / 7e-25 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10030680 [exp] 91 / 1e-24 AT5G15230 131 / 5e-41 GAST1 protein homolog 4 (.1.2) Lus10005241 [exp] 87 / 2e-23 ND 96 / 4e-27
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G044400 [exp] 131 / 1e-40 AT1G74670 108 / 9e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.001G254100 [exp] 112 / 2e-33 AT1G74670 111 / 4e-33 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.017G124200 [exp] 90 / 1e-24 AT3G02885 101 / 1e-29 GAST1 protein homolog 5 (.1) Potri.001G315500 [exp] 87 / 2e-23 AT2G30810 91 / 5e-25 Gibberellin-regulated family protein (.1) Potri.014G020100 [exp] 73 / 5e-18 AT5G59845 99 / 9e-29 Gibberellin-regulated family protein (.1) Potri.017G083000 [exp] 71 / 5e-17 AT5G15230 116 / 3e-35 GAST1 protein homolog 4 (.1.2) Potri.001G297700 [exp] 61 / 2e-13 AT2G14900 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.009G092600 [exp] 61 / 3e-13 AT2G14900 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.013G113400 [exp] 60 / 9e-13 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.019G083900 [exp] 58 / 4e-12 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [flax] [poplar] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Lus10042012 pacid=23153541 polypeptide=Lus10042012 locus=Lus10042012.g ID=Lus10042012.BGIv1.0 annot-version=v1.0 ATGAAGATCAAGAGAATGTACTACTACTTTGTGTTTCCTTTCCTTCTTCTTAACATTCTTACACTTCACAATCACGCTGCAGCAGCTATCTTCGAGTCTC CAGCACCCCAACCTCAACCTAACAATGGCAGTAACAGTACTAACACCCTCCCTTCTACTGGAACAACTGAAGGAAGCCTTCACCCTCAGGGGAGGTGCGG GGTGAGATGCTCAAAGACACAATACAAGAAGCCATGCTTGTTCTTCTGCCAAAAATGCTGTGCTAAGTGCCTCTGTGTTCCTTCTGGTACTTACGGCCAC AAGCAATCCTGCCCTTGCTACAATAACTTGAAAACCAAACGTGGTGGCCCTAAATGCCCTTGA
AA sequence Show only first row Show all	>Lus10042012 pacid=23153541 polypeptide=Lus10042012 locus=Lus10042012.g ID=Lus10042012.BGIv1.0 annot-version=v1.0 MKIKRMYYYFVFPFLLLNILTLHNHAAAAIFESPAPQPQPNNGSNSTNTLPSTGTTEGSLHPQGRCGVRCSKTQYKKPCLFFCQKCCAKCLCVPSGTYGH KQSCPCYNNLKTKRGGPKCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10042012 [exp]	0	1
AT5G06710	HD	HAT14	homeobox from Arabidopsis thal...		Lus10016254 [exp]	8.6	0.8571
AT2G37900			Major facilitator superfamily ...		Lus10012663 [exp]	9.5	0.8825
AT3G19940			Major facilitator superfamily ...		Lus10028729 [exp]	13.0	0.8194
AT3G25280			Major facilitator superfamily ...		Lus10025881 [exp]	14.5	0.7815
AT1G59740			Major facilitator superfamily ...		Lus10024457 [exp]	16.6	0.8478
AT3G07390		AIR12	Auxin-Induced in Root cultures...		Lus10038224 [exp]	18.0	0.8547
AT1G56430		ATNAS4	ARABIDOPSIS THALIANA NICOTIANA...		Lus10010917 [exp]	18.5	0.8198
AT2G23600		ATMES2, ACL, AT...	ARABIDOPSIS THALIANA METHYL ES...		Lus10019645 [exp]	19.2	0.7639
AT4G18760		AtRLP51	receptor like protein 51 (.1)		Lus10007294 [exp]	21.4	0.8506
AT1G31320	AS2	LBD4	LOB domain-containing protein ...		Lus10018275 [exp]	25.6	0.8082

Compare expression of checked genes

Lus10042012 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.