Lus10042014 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G41430 100 / 9e-28 LSR1, CID1, ERD15 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
AT4G14270 69 / 2e-15 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018018 245 / 8e-85 AT2G41430 102 / 8e-29 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10031029 169 / 5e-55 AT2G41430 115 / 3e-34 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10035419 162 / 1e-52 AT2G41430 113 / 2e-33 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10019769 89 / 6e-23 AT2G41430 91 / 1e-23 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10016358 89 / 7e-23 AT2G41430 83 / 1e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10040964 64 / 1e-13 AT2G41430 69 / 2e-15 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Lus10009847 54 / 9e-10 AT2G41430 63 / 3e-13 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G041600 138 / 2e-42 AT2G41430 121 / 1e-35 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Potri.006G044600 135 / 2e-41 AT2G41430 122 / 3e-36 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Potri.001G023100 91 / 1e-23 AT4G14270 89 / 3e-23 unknown protein
Potri.003G202500 86 / 8e-22 AT2G41430 81 / 5e-20 CTC-Interacting Domain 1, dehydration-induced protein (ERD15) (.1), dehydration-induced protein (ERD15) (.2), dehydration-induced protein (ERD15) (.3), dehydration-induced protein (ERD15) (.4), dehydration-induced protein (ERD15) (.5)
Potri.010G182800 61 / 2e-12 AT4G14270 65 / 6e-14 unknown protein
Potri.008G074600 59 / 7e-12 AT4G14270 66 / 2e-14 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07145 PAM2 Ataxin-2 C-terminal region
Representative CDS sequence
>Lus10042014 pacid=23153967 polypeptide=Lus10042014 locus=Lus10042014.g ID=Lus10042014.BGIv1.0 annot-version=v1.0
ATGGCTTTGGTATCAGGAGGAAGGTCAACTCTAAACCCGGATGCACCGCCTTTCATTCCAGCAGCTTACAAGCAAGTAGCGGATTTCTCCCCAGAATGGT
GGCAGCTGGTTACAACCACAACATGGTACAAAGACTACTGGATCAGCCAGCATCAAAACGAGGAAGGTCTCTACAACGATGCACAGGTTCAATATCATGA
TGATGGTGATCTTGACAGCAAAGATATAGCCGGGTTGCTACCAGATACATTTGATCTTGATGTCGGGGCAGGGGTCAATTTCTCTGCTTTCGACGGTTTT
GTTGAATCGTACGAATCCGAGTCAGAGAATAGAACAACACCTCAGACTGTACCCTCCTATGGAAATAGTTATTCTGGTTATGCAATTGGAGGAGGAGCTA
TGGCTCCTCCGGCAGCAGCGGTAGTGAACCAAAGCTGA
AA sequence
>Lus10042014 pacid=23153967 polypeptide=Lus10042014 locus=Lus10042014.g ID=Lus10042014.BGIv1.0 annot-version=v1.0
MALVSGGRSTLNPDAPPFIPAAYKQVADFSPEWWQLVTTTTWYKDYWISQHQNEEGLYNDAQVQYHDDGDLDSKDIAGLLPDTFDLDVGAGVNFSAFDGF
VESYESESENRTTPQTVPSYGNSYSGYAIGGGAMAPPAAAVVNQS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G41430 LSR1, CID1, ERD... CTC-Interacting Domain 1, dehy... Lus10042014 0 1
AT1G44542 Cyclase family protein (.1) Lus10014091 2.0 0.9240
AT4G31130 Protein of unknown function (D... Lus10026052 2.4 0.9299
AT4G33430 SERK3, RKS10, E... RECEPTOR KINASES LIKE SERK 10,... Lus10025358 3.9 0.9199
AT5G11680 unknown protein Lus10027000 4.6 0.9155
AT5G44080 bZIP Basic-leucine zipper (bZIP) tr... Lus10028575 5.8 0.9004
AT5G50380 ATEXO70F1 exocyst subunit exo70 family p... Lus10016764 6.2 0.9094
AT5G39360 EDL2 EID1-like 2 (.1) Lus10018196 6.4 0.8980
AT4G15940 Fumarylacetoacetate (FAA) hydr... Lus10006496 8.0 0.9202
AT5G63030 GRXC1 glutaredoxin C1, Thioredoxin s... Lus10001237 9.5 0.9103
AT4G27880 Protein with RING/U-box and TR... Lus10018110 9.5 0.9136

Lus10042014 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.