Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47790 48 / 5e-07 F-box and associated interaction domains-containing protein (.1) AT2G41473 43 / 4e-06 F-box family protein (.1) AT5G10340 45 / 6e-06 F-box family protein (.1) AT1G15015 44 / 1e-05 F-box family protein (.1) AT1G11620 44 / 2e-05 F-box and associated interaction domains-containing protein (.1) AT2G02030 43 / 2e-05 F-box family protein (.1) AT1G11270 42 / 4e-05 F-box and associated interaction domains-containing protein (.1.2.3) AT1G46840 42 / 5e-05 F-box family protein (.1) AT5G16285 40 / 5e-05 F-box family protein (.1) AT1G12170 42 / 6e-05 F-box family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031512 [exp] 52 / 2e-08 AT3G16210 100 / 8e-23 F-box family protein (.1) Lus10015170 [exp] 49 / 1e-07 AT5G50220 46 / 2e-06 F-box family protein (.1) Lus10040463 [exp] 49 / 3e-07 AT4G12560 117 / 7e-29 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10006734 [exp] 44 / 1e-06 AT1G30920 54 / 4e-10 F-box family protein (.1) Lus10007486 [exp] 44 / 2e-06 AT2G41473 47 / 2e-07 F-box family protein (.1) Lus10026816 [exp] 45 / 8e-06 AT4G12560 63 / 1e-10 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10013872 [exp] 44 / 1e-05 AT3G06240 101 / 2e-23 F-box family protein (.1) Lus10010910 [exp] 44 / 1e-05 AT3G23880 101 / 1e-23 F-box and associated interaction domains-containing protein (.1) Lus10013215 [exp] 44 / 2e-05 AT5G42350 647 / 0.0 Galactose oxidase/kelch repeat superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G121200 [exp] 54 / 5e-09 AT4G12560 116 / 9e-29 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.006G170300 [exp] 52 / 3e-08 AT4G12560 69 / 1e-12 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.006G010800 [exp] 49 / 2e-07 AT4G12560 159 / 2e-44 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.003G145950 [exp] 49 / 3e-07 AT4G12560 113 / 7e-28 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.012G014700 [exp] 49 / 4e-07 AT1G12170 66 / 1e-11 F-box family protein (.1) Potri.008G199601 [exp] 46 / 4e-07 AT3G06240 61 / 2e-12 F-box family protein (.1) Potri.018G007900 [exp] 48 / 7e-07 AT2G04920 63 / 1e-10 F-box and associated interaction domains-containing protein (.1) Potri.005G114900 [exp] 47 / 1e-06 AT3G21410 73 / 9e-14 F-box and associated interaction domains-containing protein (.1) Potri.006G013000 [exp] 47 / 1e-06 AT4G12560 250 / 5e-79 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.008G199800 [exp] 47 / 2e-06 AT3G23880 182 / 3e-53 F-box and associated interaction domains-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10042015 pacid=23153506 polypeptide=Lus10042015 locus=Lus10042015.g ID=Lus10042015.BGIv1.0 annot-version=v1.0 ATGTCCGACTGGATCCCCCGGAAGAAGCAGGCAGCGACATCCGACTGGATCCTCGACGAAATTGTCACCCGAGAAATCCTATTCCGGCTGCCGGTGCTTT CCCTCCTCAACTTCCGATGCGTCTGCAAGCAATGGCGGATGCTCATAGACAGCCCCGACTTCATCAAACGCCAAATCGATCACTCCGTCTCCACCACCCG AAACGTCGTGCTCTTCCTTCTCTACAACGGTGACGACAGCCTCTACCCAGTCCCCTACTTGTCCGGCCTCCGACCCGGTTACGATTCATCAATAGGGGGA AAAACAGAGGTGAAGGTTGGCAGACACATGGAACCAGGGTATGAAGATGAAGATCGATATGATATTGAGTACGACCTTGATTATGAGCACCACGGATGCG ATTGTGGATATGACCCGGATGAAGGCGACATTAGCGGCTTGGATCACGGTCAAGAACGGGGTTTGTGA
AA sequence Show only first row Show all	>Lus10042015 pacid=23153506 polypeptide=Lus10042015 locus=Lus10042015.g ID=Lus10042015.BGIv1.0 annot-version=v1.0 MSDWIPRKKQAATSDWILDEIVTREILFRLPVLSLLNFRCVCKQWRMLIDSPDFIKRQIDHSVSTTRNVVLFLLYNGDDSLYPVPYLSGLRPGYDSSIGG KTEVKVGRHMEPGYEDEDRYDIEYDLDYEHHGCDCGYDPDEGDISGLDHGQERGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G47790			F-box and associated interacti...		Lus10042015 [exp]	0	1
AT5G13840		FZR3	FIZZY-related 3 (.1.2)		Lus10002972 [exp]	5.7	1.0000
AT1G18720			Protein of unknown function (D...		Lus10001647 [exp]	6.0	1.0000
					Lus10006079 [exp]	9.5	1.0000
AT4G28780			GDSL-like Lipase/Acylhydrolase...		Lus10023578 [exp]	11.0	1.0000
AT1G15780			unknown protein		Lus10023978 [exp]	12.2	1.0000
AT2G23810		TET8	tetraspanin8 (.1)		Lus10027256 [exp]	14.0	1.0000
AT3G48770			DNA binding;ATP binding (.1)		Lus10032551 [exp]	15.5	1.0000
AT1G18720			Protein of unknown function (D...		Lus10021660 [exp]	16.4	1.0000
AT5G64820			unknown protein		Lus10025572 [exp]	17.3	1.0000
AT2G40070			unknown protein		Lus10008717 [exp]	17.9	1.0000

Compare expression of checked genes

Lus10042015 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.