Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018021 [exp] 231 / 2e-71 AT4G12010 434 / 5e-131 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10009107 [exp] 74 / 3e-16 AT4G12010 347 / 4e-101 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10019654 [exp] 55 / 1e-09 AT4G12010 376 / 2e-110 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10015648 [exp] 55 / 1e-09 AT4G12010 420 / 1e-126 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10024150 [exp] 51 / 4e-08 AT1G69550 186 / 9e-49 disease resistance protein (TIR-NBS-LRR class) (.1) Lus10042778 [exp] 44 / 1e-05 AT4G12010 185 / 1e-48 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10001537 [exp] 43 / 2e-05 AT5G44510 175 / 1e-45 target of AVRB operation1 (.1) Lus10023051 [exp] 42 / 4e-05 AT4G12010 415 / 2e-125 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10010223 [exp] 40 / 0.0001 AT5G17680 218 / 6e-58 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042018 pacid=23153797 polypeptide=Lus10042018 locus=Lus10042018.g ID=Lus10042018.BGIv1.0 annot-version=v1.0 ATGATGATCAAGGGGATTGCATTTGGCGTTGTGCTATCGGTGGATGTACCAACTGTTGCCTTGCATCTTAACTGCGATTGCAATGACCGCCACAGCAGCA TCACTACAGTTTCTTTTCGGAGTTTGGCATTTCAGATTTACGGTGGTGAGGCGGTAGGATCGTCAGAGTATGTATGTCTGTGTTTTGACGAGAAGTTATC AGGTGATCAGAGCACGGAAGGAATCAAGGTGGAGCAACAAGAAGAAGAAACCGCAGCTTGGTTTGCGCAACGGGCTGGAAGGGTCGTTTCGTTTCGAGTT TACCCGCAAATACGGGGAGAAGATCCCAGGATATTAAAGAGTGTCAAAATCAGAAGCATTGCCGTTTCTCTGCTCTACTGA
AA sequence Show only first row Show all	>Lus10042018 pacid=23153797 polypeptide=Lus10042018 locus=Lus10042018.g ID=Lus10042018.BGIv1.0 annot-version=v1.0 MMIKGIAFGVVLSVDVPTVALHLNCDCNDRHSSITTVSFRSLAFQIYGGEAVGSSEYVCLCFDEKLSGDQSTEGIKVEQQEEETAAWFAQRAGRVVSFRV YPQIRGEDPRILKSVKIRSIAVSLLY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10042018 [exp]	0	1
AT2G41290		SSL2	strictosidine synthase-like 2 ...		Lus10010448 [exp]	3.7	0.7247
AT4G36470			S-adenosyl-L-methionine-depend...		Lus10041380 [exp]	7.5	0.7076
AT3G50120			Plant protein of unknown funct...		Lus10019324 [exp]	11.0	0.7296
AT1G11340			S-locus lectin protein kinase ...		Lus10013247 [exp]	23.9	0.6587
AT1G28480		roxy19, GRX480	Thioredoxin superfamily protei...		Lus10033649 [exp]	26.5	0.6456
AT5G48580		FKBP15-2	FK506- and rapamycin-binding p...		Lus10035800 [exp]	30.6	0.6930
AT5G46760	bHLH	bHLH005, ATR2, ...	Basic helix-loop-helix (bHLH) ...		Lus10035365 [exp]	46.7	0.6721
AT3G12620			Protein phosphatase 2C family ...		Lus10040346 [exp]	46.9	0.6594
					Lus10039884 [exp]	49.6	0.5671
AT2G33390			unknown protein		Lus10011781 [exp]	51.7	0.6635

Compare expression of checked genes

Lus10042018 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.