Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G52490 38 / 0.0002 Fibrillarin family protein (.1) AT5G52470 37 / 0.0008 ATFIB1, ATFBR1, SKIP7, FIB1 SKP1/ASK1-INTERACTING PROTEIN, fibrillarin 1 (.1.2) AT4G25630 36 / 0.0008 ATFIB2, FIB2 fibrillarin 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018028 [exp] 86 / 3e-23 ND 41 / 5e-05
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G192700 [exp] 39 / 0.0001 AT5G52470 378 / 2e-132 SKP1/ASK1-INTERACTING PROTEIN, fibrillarin 1 (.1.2) Potri.015G147500 [exp] 37 / 0.0008 AT5G52470 462 / 1e-165 SKP1/ASK1-INTERACTING PROTEIN, fibrillarin 1 (.1.2) Potri.012G144800 [exp] 37 / 0.0008 AT4G25630 463 / 1e-165 fibrillarin 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF01269 [flax] [poplar] Fibrillarin Fibrillarin
Representative CDS sequence Show only first row Show all	>Lus10042024 pacid=23153999 polypeptide=Lus10042024 locus=Lus10042024.g ID=Lus10042024.BGIv1.0 annot-version=v1.0 ATGTTAGATCGTGTTGGACCTAGTGGACAGGTTATTGCAGTAGAGAAAGATGAGATCTACATGACTGATTTGGAGGAGCTCTCCTCAATGAATAACAATC TGACTGTACTTATTGCAGATCCAGAAAACCCGTCTTACTCATTACCGCTGCTCGATGTCATATTTTGTGACATTGATCATCATGATCAGAAACAGAGAGG AAGAAGAGTTGGAACACTCCCACAGTGGCTAGCGGCAGGCGGCGGTGAATAA
AA sequence Show only first row Show all	>Lus10042024 pacid=23153999 polypeptide=Lus10042024 locus=Lus10042024.g ID=Lus10042024.BGIv1.0 annot-version=v1.0 MLDRVGPSGQVIAVEKDEIYMTDLEELSSMNNNLTVLIADPENPSYSLPLLDVIFCDIDHHDQKQRGRRVGTLPQWLAAGGGE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10042024 [exp]	0	1
AT1G71530			Protein kinase superfamily pro...		Lus10001470 [exp]	2.4	0.9700
AT1G02170		AtMCP1b, ATMC1,...	LSD ONE LIKE 3, ARABIDOPSIS TH...		Lus10035628 [exp]	4.5	0.9251
AT5G52170	HD	HDG7	homeodomain GLABROUS 7 (.1)		Lus10035095 [exp]	5.2	0.9545
					Lus10014195 [exp]	5.5	0.9587
AT3G06530			ARM repeat superfamily protein...		Lus10026144 [exp]	5.5	0.9488
					Lus10020194 [exp]	7.2	0.9525
AT2G30900		TBL43	TRICHOME BIREFRINGENCE-LIKE 43...		Lus10007367 [exp]	7.5	0.9401
					Lus10042276 [exp]	9.1	0.8232
AT1G09080		BIP3	binding protein 3, Heat shock ...		Lus10013055 [exp]	9.8	0.9442
					Lus10002291 [exp]	10.6	0.9332

Compare expression of checked genes

Lus10042024 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.