Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G19740 166 / 1e-54 Ribosomal protein L31e family protein (.1) AT5G56710 166 / 1e-54 Ribosomal protein L31e family protein (.1.2) AT4G26230 166 / 1e-54 Ribosomal protein L31e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025830 [exp] 199 / 1e-67 AT2G19740 200 / 5e-68 Ribosomal protein L31e family protein (.1) Lus10018032 [exp] 195 / 7e-66 AT2G19740 191 / 3e-64 Ribosomal protein L31e family protein (.1) Lus10038272 [exp] 199 / 6e-63 AT2G19740 200 / 9e-63 Ribosomal protein L31e family protein (.1) Lus10015698 [exp] 166 / 1e-54 AT5G56710 201 / 2e-68 Ribosomal protein L31e family protein (.1.2) Lus10037703 [exp] 165 / 6e-54 AT5G56710 199 / 1e-67 Ribosomal protein L31e family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G070100 [exp] 174 / 1e-57 AT2G19740 170 / 6e-56 Ribosomal protein L31e family protein (.1) Potri.009G064100 [exp] 164 / 1e-53 AT2G19740 164 / 1e-53 Ribosomal protein L31e family protein (.1) Potri.001G269600 [exp] 161 / 2e-52 AT2G19740 162 / 5e-53 Ribosomal protein L31e family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01198 [flax] [poplar] Ribosomal_L31e Ribosomal protein L31e
Representative CDS sequence Show only first row Show all	>Lus10042028 pacid=23153549 polypeptide=Lus10042028 locus=Lus10042028.g ID=Lus10042028.BGIv1.0 annot-version=v1.0 ATGGTTGAGAAGACTAGGATCAGGAAAGAGGAGGTGGTGACCAGAGAGTACACCATCAACCTTCACAAGCGGTTGCACGGATGCACATTCAAGAAGAAGG CTCCTAAGGCCATCAAGGAGATCAGGAAGTTTGCTGAGAAGGCTATGGGGACGAAGGATGTCAGAGTGGACGTGAAGCTGAACAAGCAAATCTGGAGCAA GGGTATCAGGAGTGTTCCAAGGAGAATCAGGGTTCGCATTGCACGGAAGAGGAACGATGATGAAGATGCAAAGGAGGAGCTCTATTCCCTCGTTACTGTT GCTGAGGCACCAGAAGGACTCAAGGGGTTGAGCACAAAGATTATAGAAGATGAAGAGTAA
AA sequence Show only first row Show all	>Lus10042028 pacid=23153549 polypeptide=Lus10042028 locus=Lus10042028.g ID=Lus10042028.BGIv1.0 annot-version=v1.0 MVEKTRIRKEEVVTREYTINLHKRLHGCTFKKKAPKAIKEIRKFAEKAMGTKDVRVDVKLNKQIWSKGIRSVPRRIRVRIARKRNDDEDAKEELYSLVTV AEAPEGLKGLSTKIIEDEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G19740			Ribosomal protein L31e family ...		Lus10042028 [exp]	0	1
AT3G23390			Zinc-binding ribosomal protein...		Lus10013436 [exp]	1.4	0.9462
AT2G20450			Ribosomal protein L14 (.1)		Lus10024918 [exp]	1.4	0.9428
AT3G53740			Ribosomal protein L36e family ...		Lus10016501 [exp]	2.4	0.9281
AT3G52570			alpha/beta-Hydrolases superfam...		Lus10021315 [exp]	3.9	0.9201
AT1G26880			Ribosomal protein L34e superfa...		Lus10036750 [exp]	4.0	0.9255
AT2G44620		MTACP1, MTACP-1	mitochondrial acyl carrier pro...		Lus10043348 [exp]	4.7	0.8731
AT2G18400			ribosomal protein L6 family pr...		Lus10026015 [exp]	5.2	0.8874
AT2G34160			Alba DNA/RNA-binding protein (...		Lus10002027 [exp]	5.5	0.9076
AT1G70350			unknown protein		Lus10013008 [exp]	5.7	0.8907
AT2G44620		MTACP1, MTACP-1	mitochondrial acyl carrier pro...		Lus10019500 [exp]	6.3	0.8418

Compare expression of checked genes

Lus10042028 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.