Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G41600 59 / 5e-12 Mitochondrial glycoprotein family protein (.1.2.3.4.5) AT5G02050 43 / 4e-06 Mitochondrial glycoprotein family protein (.1) AT1G80720 40 / 5e-05 Mitochondrial glycoprotein family protein (.1) AT4G31930 39 / 0.0002 Mitochondrial glycoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024351 [exp] 46 / 6e-07 AT5G02050 231 / 6e-76 Mitochondrial glycoprotein family protein (.1) Lus10012653 [exp] 44 / 2e-06 AT5G02050 201 / 2e-65 Mitochondrial glycoprotein family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G046350 [exp] 53 / 8e-10 AT2G41600 210 / 2e-69 Mitochondrial glycoprotein family protein (.1.2.3.4.5) Potri.006G090700 [exp] 41 / 2e-05 AT5G02050 228 / 9e-75 Mitochondrial glycoprotein family protein (.1) Potri.016G102200 [exp] 39 / 0.0001 AT5G02050 216 / 4e-70 Mitochondrial glycoprotein family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02330 [flax] [poplar] MAM33 Mitochondrial glycoprotein
Representative CDS sequence Show only first row Show all	>Lus10042041 pacid=23154038 polypeptide=Lus10042041 locus=Lus10042041.g ID=Lus10042041.BGIv1.0 annot-version=v1.0 ATGGATGTTGAAGATATTTTCCGTTTTGACAATGGTGACTCCGATAATCTCATTGTCTTTACTAGAATCCGAAGTCAGCTTGTATATGGTTTGCTTAAAC TCCATACGTTGGACGCTAATTTACAAGGTGCGTTTCAAGACTACCTGCTTGCAAAGGGAATTACTCAATACCTCCTTTACTTTCTCCTTGAACACTTGCA CAAGAAGGAGCAAGGTCAATATGTGAGTTGGTTGCAGAAGCTTGAATCAATGATTGCTGGGAAGACAAAACATGATGATGCAGAATAA
AA sequence Show only first row Show all	>Lus10042041 pacid=23154038 polypeptide=Lus10042041 locus=Lus10042041.g ID=Lus10042041.BGIv1.0 annot-version=v1.0 MDVEDIFRFDNGDSDNLIVFTRIRSQLVYGLLKLHTLDANLQGAFQDYLLAKGITQYLLYFLLEHLHKKEQGQYVSWLQKLESMIAGKTKHDDAE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G41600			Mitochondrial glycoprotein fam...		Lus10042041 [exp]	0	1
AT3G15395			unknown protein		Lus10039067 [exp]	1.4	0.7616
AT2G41600			Mitochondrial glycoprotein fam...		Lus10042042 [exp]	1.4	0.7552
AT5G47630		MTACP3	mitochondrial acyl carrier pro...		Lus10038782 [exp]	3.9	0.7437
AT3G27050			unknown protein		Lus10010600 [exp]	4.2	0.6661
AT3G02950		AtTHO7	Tho complex subunit 7/Mft1p (....		Lus10012882 [exp]	6.6	0.7242
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10042695 [exp]	9.5	0.7170
AT2G39170			unknown protein		Lus10018298 [exp]	15.2	0.6563
AT4G14660		NRPE7	RNA polymerase Rpb7-like, N-te...		Lus10023619 [exp]	20.0	0.6955
AT1G06530		PMD2	peroxisomal and mitochondrial ...		Lus10031394 [exp]	28.0	0.7038
AT3G59520		ATRBL13	RHOMBOID-like protein 13 (.1)		Lus10008156 [exp]	33.8	0.6902

Compare expression of checked genes

Lus10042041 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.