Lus10042042 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G41600 119 / 5e-35 Mitochondrial glycoprotein family protein (.1.2.3.4.5)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G046350 159 / 6e-50 AT2G41600 210 / 2e-69 Mitochondrial glycoprotein family protein (.1.2.3.4.5)
PFAM info
Representative CDS sequence
>Lus10042042 pacid=23153808 polypeptide=Lus10042042 locus=Lus10042042.g ID=Lus10042042.BGIv1.0 annot-version=v1.0
ATGGTTCGTCGCGTGGTGCCCGTCTTCCGACAAGCTGGGCGAGCGCTTGAAAACTCCAACTTGATCAATGCCTTACGATCAGAGATCAACCACGAACTCT
CCACTCCCACTTCCTTCCAGAACAATCCGGTCGCCTTGCCGGAGGATTTTATCATGGACTGGGATTCTTCAGAATCCGAGGATGTAGTGTTGAGGAGGAA
AACAGAGTCCGGCGAGGAAGTTGCGGTATCTGCGTTGCTGGGGCCGCTTCTCCCTGTGGAATGGGGGCCGACGTTCCCGAGAGATGTTTTGATGAAGGTT
TGCGTTAAGAAACCTGGATGCAGCTCTTTGTTACAGTTCGATTGTCAAGCGTATGAGGGTGCTCCGTTGTGTATCCGTGCAGCAAATTTTCTCCAATCAA
ACGACTGCCCCCGTCCTTCTGCCTACAAAGGTCCCTTGTTCAGGTGA
AA sequence
>Lus10042042 pacid=23153808 polypeptide=Lus10042042 locus=Lus10042042.g ID=Lus10042042.BGIv1.0 annot-version=v1.0
MVRRVVPVFRQAGRALENSNLINALRSEINHELSTPTSFQNNPVALPEDFIMDWDSSESEDVVLRRKTESGEEVAVSALLGPLLPVEWGPTFPRDVLMKV
CVKKPGCSSLLQFDCQAYEGAPLCIRAANFLQSNDCPRPSAYKGPLFR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G41600 Mitochondrial glycoprotein fam... Lus10042042 0 1
AT2G41600 Mitochondrial glycoprotein fam... Lus10042041 1.4 0.7552
AT2G02050 NADH-ubiquinone oxidoreductase... Lus10035094 7.9 0.7462
AT5G04940 SUVH1 SU(VAR)3-9 homolog 1 (.1), SU(... Lus10008680 8.5 0.7059
AT3G26360 Ribosomal protein S21 family p... Lus10006466 11.8 0.6955
AT2G27020 PAG1 20S proteasome alpha subunit G... Lus10041296 12.0 0.7026
Lus10008962 12.4 0.6881
AT5G37475 Translation initiation factor ... Lus10028057 18.5 0.6806
AT2G32520 alpha/beta-Hydrolases superfam... Lus10035287 18.7 0.6998
AT1G21720 PBC1 proteasome beta subunit C1 (.1... Lus10004885 19.8 0.6896
AT1G47420 SDH5 succinate dehydrogenase 5 (.1) Lus10042661 22.8 0.6718

Lus10042042 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.