Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34700 164 / 9e-54 CIB22, AtCIB22 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018052 [exp] 178 / 4e-58 AT4G34700 179 / 5e-58 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1) Lus10031084 [exp] 167 / 5e-55 AT4G34700 176 / 1e-58 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1) Lus10035469 [exp] 167 / 5e-54 AT4G34700 176 / 2e-57 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G163000 [exp] 184 / 9e-62 AT4G34700 174 / 1e-57 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1) Potri.009G124600 [exp] 183 / 2e-61 AT4G34700 171 / 9e-57 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042049 pacid=23154002 polypeptide=Lus10042049 locus=Lus10042049.g ID=Lus10042049.BGIv1.0 annot-version=v1.0 ATGAGTTTGGCATCTACGGCGGCTTACGCTGCTCGGCGGGCAGCACAGAGGGAGCGGGTTCGGATCCTTTACCGCCGGGCTCTCAAGGACACTCTGAACT GGGCAGTCCACCGACACCTCTTCTATGAAGATGCTGACAATCTTCGCGCCAGGTTTGAGGTGAACAAAGGAGTGGAGGATCTGGACACAATAGATAGGCT CATTGTTGACTGCGAGGCACAGTACAACAAGTGGCGGCACCCTGATCCGTACATTGTTCCATGGGCTCCTGGTGGTTCTAAGTTCACTCGAAACCCAACT CCGCCAGAAGGGATAGAGATCATCTACAATTATGGACGAGAAGATAATGACTGA
AA sequence Show only first row Show all	>Lus10042049 pacid=23154002 polypeptide=Lus10042049 locus=Lus10042049.g ID=Lus10042049.BGIv1.0 annot-version=v1.0 MSLASTAAYAARRAAQRERVRILYRRALKDTLNWAVHRHLFYEDADNLRARFEVNKGVEDLDTIDRLIVDCEAQYNKWRHPDPYIVPWAPGGSKFTRNPT PPEGIEIIYNYGREDND

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34700		CIB22, AtCIB22	B22 subunit of eukaryotic mito...		Lus10042049 [exp]	0	1
AT4G34700		CIB22, AtCIB22	B22 subunit of eukaryotic mito...		Lus10018052 [exp]	2.2	0.8950
AT1G30890			Integral membrane HRF1 family ...		Lus10027039 [exp]	4.0	0.9121
AT3G05545			RING/U-box superfamily protein...		Lus10020655 [exp]	4.5	0.9027
AT1G12640			MBOAT (membrane bound O-acyl t...		Lus10006325 [exp]	4.9	0.9025
AT4G22550			Phosphatidic acid phosphatase ...		Lus10004345 [exp]	9.5	0.8777
AT1G65270			unknown protein		Lus10026847 [exp]	11.7	0.8741
AT3G44150			unknown protein		Lus10029366 [exp]	13.3	0.8957
AT5G37600		ATGLN1;1, GLN1;...	ARABIDOPSIS THALIANA GLUTAMINE...		Lus10017404 [exp]	16.6	0.8803
AT1G16210			unknown protein		Lus10012520 [exp]	19.0	0.8525
AT5G24400		PGL3, EMB2024	6-PHOSPHOGLUCONOLACTONASE 3, E...		Lus10022352 [exp]	19.0	0.8816

Compare expression of checked genes

Lus10042049 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.