Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57450 66 / 2e-15 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018070 [exp] 80 / 6e-21 AT3G57450 66 / 1e-15 unknown protein Lus10035455 [exp] 72 / 6e-18 AT3G57450 69 / 3e-17 unknown protein Lus10031071 [exp] 72 / 8e-18 AT3G57450 69 / 5e-17 unknown protein Lus10019730 [exp] 59 / 1e-12 AT3G57450 66 / 8e-16 unknown protein Lus10016391 [exp] 59 / 1e-12 AT3G57450 66 / 1e-15 unknown protein Lus10029496 [exp] 57 / 6e-12 AT3G57450 64 / 6e-15 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G055901 [exp] 75 / 5e-19 AT3G57450 70 / 2e-17 unknown protein Potri.001G263404 [exp] 65 / 4e-15 AT3G57450 64 / 3e-15 unknown protein Potri.006G050800 [exp] 64 / 9e-15 AT3G57450 59 / 4e-13 unknown protein Potri.012G032500 [exp] 54 / 2e-10 AT3G57450 66 / 2e-15 unknown protein Potri.009G058500 [exp] 49 / 1e-08 AT3G57450 47 / 1e-08 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042063 pacid=23153657 polypeptide=Lus10042063 locus=Lus10042063.g ID=Lus10042063.BGIv1.0 annot-version=v1.0 ATGAGTAAGTACGTGGAGTTGTTGGACGCCGCGGTCAGATTCGCCGGGAGATTTTACACGCACTGCCCTCAAACTGCTCGCCTCTACTACCATCCTCCTT CAAATTCCCACCTCGCCGGCGCTGCTGCCTCTAGGCGCGCGCTGCGGCCTCTAGCGCTCAGCCGGCCTGCGACAAATCGACTCGTGACAGCAAATCCGCT GCTGCTGCTGGTTTTGCTTTGGAGGCTTCCTTGGGGGGGTTTGATTCTTCTGCGCATCAGTTGGTGCGTCTTACTCTTCTCTGAGGCCAAGATCAAGAAT TCAAGATTAATTGACTCCAAGGAAAGATAA
AA sequence Show only first row Show all	>Lus10042063 pacid=23153657 polypeptide=Lus10042063 locus=Lus10042063.g ID=Lus10042063.BGIv1.0 annot-version=v1.0 MSKYVELLDAAVRFAGRFYTHCPQTARLYYHPPSNSHLAGAAASRRALRPLALSRPATNRLVTANPLLLLVLLWRLPWGGLILLRISWCVLLFSEAKIKN SRLIDSKER

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G57450			unknown protein		Lus10042063 [exp]	0	1
AT5G42050			DCD (Development and Cell Deat...		Lus10023059 [exp]	2.2	0.8784
AT2G25250			unknown protein		Lus10041025 [exp]	6.0	0.8761
					Lus10023370 [exp]	8.5	0.8675
AT1G08250		AtADT6, ADT6	Arabidopsis thaliana arogenate...		Lus10019526 [exp]	11.1	0.8632
AT4G17500	AP2_ERF	ATERF-1, AtERF1	ethylene responsive element bi...		Lus10004368 [exp]	11.2	0.8453
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10012224 [exp]	13.7	0.8414
AT4G25030			unknown protein		Lus10041415 [exp]	14.0	0.8311
AT1G55910		ZIP11	zinc transporter 11 precursor ...		Lus10004413 [exp]	14.7	0.8336
AT1G51200			A20/AN1-like zinc finger famil...		Lus10004889 [exp]	15.3	0.8483
AT3G16210			F-box family protein (.1)		Lus10023372 [exp]	17.9	0.8496

Compare expression of checked genes

Lus10042063 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.