Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38960 112 / 5e-32 CO B-box type zinc finger family protein (.1.2.3) AT2G21320 102 / 4e-28 CO B-box zinc finger family protein (.1) AT1G75540 76 / 5e-17 CO LHUS, AtBBX21, STH2 long hypocotyl under shade, B-box domain protein 21, B BOX 21, salt tolerance homolog2 (.1) AT1G78600 74 / 3e-16 CO BBX22, DBB3, STH3, LZF1 SALT TOLERANCE HOMOLOG 3, DOUBLE B-BOX 3, B-box domain protein 22, light-regulated zinc finger protein 1 (.1.2) AT2G24790 68 / 3e-14 CO COL3, ATCOL3 CONSTANS-like 3 (.1.2) AT4G39070 66 / 1e-13 CO B-box zinc finger family protein (.1) AT2G31380 66 / 1e-13 CO STH salt tolerance homologue (.1) AT5G24930 66 / 3e-13 CO COL4, ATCOL4 CONSTANS-like 4 (.1) AT1G06040 64 / 7e-13 CO BBX24, STO SALT TOLERANCE, B-box domain protein 24, B-box zinc finger family protein (.1.2) AT4G10240 59 / 1e-11 CO B-box zinc finger family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018076 [exp] 193 / 9e-64 AT4G38960 215 / 6e-72 B-box type zinc finger family protein (.1.2.3) Lus10031087 [exp] 137 / 1e-41 AT4G38960 229 / 5e-77 B-box type zinc finger family protein (.1.2.3) Lus10035472 [exp] 132 / 2e-39 AT4G38960 229 / 4e-77 B-box type zinc finger family protein (.1.2.3) Lus10042498 [exp] 70 / 6e-15 AT1G78600 274 / 1e-91 SALT TOLERANCE HOMOLOG 3, DOUBLE B-BOX 3, B-box domain protein 22, light-regulated zinc finger protein 1 (.1.2) Lus10038147 [exp] 70 / 7e-15 AT1G78600 281 / 2e-94 SALT TOLERANCE HOMOLOG 3, DOUBLE B-BOX 3, B-box domain protein 22, light-regulated zinc finger protein 1 (.1.2) Lus10028791 [exp] 67 / 4e-14 AT1G75540 206 / 9e-66 long hypocotyl under shade, B-box domain protein 21, B BOX 21, salt tolerance homolog2 (.1) Lus10017495 [exp] 66 / 2e-13 AT1G75540 202 / 2e-64 long hypocotyl under shade, B-box domain protein 21, B BOX 21, salt tolerance homolog2 (.1) Lus10026909 [exp] 64 / 1e-12 AT5G24930 404 / 3e-140 CONSTANS-like 4 (.1) Lus10020105 [exp] 64 / 2e-12 AT5G24930 398 / 6e-138 CONSTANS-like 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G124400 [exp] 124 / 2e-36 AT4G38960 251 / 8e-86 B-box type zinc finger family protein (.1.2.3) Potri.004G162600 [exp] 113 / 5e-32 AT4G38960 248 / 1e-84 B-box type zinc finger family protein (.1.2.3) Potri.007G015200 [exp] 109 / 7e-31 AT4G38960 197 / 5e-65 B-box type zinc finger family protein (.1.2.3) Potri.005G117100 [exp] 109 / 9e-31 AT2G21320 192 / 4e-63 B-box zinc finger family protein (.1) Potri.004G161000 [exp] 71 / 1e-15 AT4G39070 192 / 6e-62 B-box zinc finger family protein (.1) Potri.001G384000 [exp] 71 / 4e-15 AT1G78600 284 / 1e-95 SALT TOLERANCE HOMOLOG 3, DOUBLE B-BOX 3, B-box domain protein 22, light-regulated zinc finger protein 1 (.1.2) Potri.005G234500 [exp] 70 / 6e-15 AT1G75540 185 / 2e-56 long hypocotyl under shade, B-box domain protein 21, B BOX 21, salt tolerance homolog2 (.1) Potri.002G028200 [exp] 70 / 6e-15 AT1G75540 252 / 2e-82 long hypocotyl under shade, B-box domain protein 21, B BOX 21, salt tolerance homolog2 (.1) Potri.018G013800 [exp] 69 / 3e-14 AT5G24930 348 / 2e-118 CONSTANS-like 4 (.1) Potri.011G105400 [exp] 68 / 3e-14 AT1G78600 284 / 1e-95 SALT TOLERANCE HOMOLOG 3, DOUBLE B-BOX 3, B-box domain protein 22, light-regulated zinc finger protein 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00643 [flax] [poplar] zf-B_box B-box zinc finger
Representative CDS sequence Show only first row Show all	>Lus10042069 pacid=23153784 polypeptide=Lus10042069 locus=Lus10042069.g ID=Lus10042069.BGIv1.0 annot-version=v1.0 ATGCGAACGCTGTGCGATGTGTGCGAAAGCGCTGCCGCCATCCTATTCTGCGCCGCCGACGAGGCTTCTCTCTGCCGCGCCTGCGATGACAAGGTTCATC TGTGTAACAAGCTAGCTAGTAGACATGTACGAGTAGCCCTCGCTGTACCAAGTGCCACCCCTTGCTGTGACATCTGCGAGAATGCGCCTGAACCCACCGT AGATACCTCTTACTCCGGCAGAGAGTCGAGGATGGACCGAAATCATCAACAGGAAGCAGATACTACACAGCATAATAGGAATGCTACCGCAACGGAGAAC CATTCCGTAGCTGGTAATGATTTAATAGACCTTAATTCAAGGCCTCGCGGGATGAATGGCGAAGATTCTACTGACCAGGAAGGTGAACTCTCGATTCTCG TTTCCAAAACCTCATTAATGATTCCTCCTCGAGCTTGA
AA sequence Show only first row Show all	>Lus10042069 pacid=23153784 polypeptide=Lus10042069 locus=Lus10042069.g ID=Lus10042069.BGIv1.0 annot-version=v1.0 MRTLCDVCESAAAILFCAADEASLCRACDDKVHLCNKLASRHVRVALAVPSATPCCDICENAPEPTVDTSYSGRESRMDRNHQQEADTTQHNRNATATEN HSVAGNDLIDLNSRPRGMNGEDSTDQEGELSILVSKTSLMIPPRA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38960	CO		B-box type zinc finger family ...		Lus10042069 [exp]	0	1
AT3G14920			Peptide-N4-(N-acetyl-beta-gluc...		Lus10025771 [exp]	9.9	0.7489
AT1G78955		CAMS1	camelliol C synthase 1 (.1)		Lus10016441 [exp]	15.6	0.7451
AT1G78950		ATLUP3	Terpenoid cyclases family prot...		Lus10016440 [exp]	19.2	0.7423
AT5G20860			Plant invertase/pectin methyle...		Lus10033621 [exp]	23.0	0.7298
AT5G20860			Plant invertase/pectin methyle...		Lus10017665 [exp]	26.6	0.7188
AT1G74300			alpha/beta-Hydrolases superfam...		Lus10032809 [exp]	27.7	0.7182
AT1G55790			Domain of unknown function (DU...		Lus10016345 [exp]	28.5	0.6841
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10012493 [exp]	30.1	0.6430
AT5G58350		ZIK2, WNK4	with no lysine (K) kinase 4 (....		Lus10009921 [exp]	31.7	0.7242
AT1G73140		TBL31	Plant protein of unknown funct...		Lus10028141 [exp]	34.1	0.7185

Compare expression of checked genes

Lus10042069 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.