Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67785 66 / 9e-17 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018082 [exp] 76 / 2e-20 AT1G67785 100 / 3e-30 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G087301 [exp] 61 / 2e-14 AT1G67785 90 / 5e-26 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042077 pacid=23153581 polypeptide=Lus10042077 locus=Lus10042077.g ID=Lus10042077.BGIv1.0 annot-version=v1.0 ATGGTGAAGGTCTCGACTTACTTCGCGATGACATTGGGCGCCTTTGTGTTTTGGCAATCGATGGATAAGCTTCATGTCTGGATCGCTCTTCACCAGGATG AAAAGGTAATAATTTATCAGTCAACCTGGCTTTCATCAGCGGAGTCGGGATTCGTTATCTGA
AA sequence Show only first row Show all	>Lus10042077 pacid=23153581 polypeptide=Lus10042077 locus=Lus10042077.g ID=Lus10042077.BGIv1.0 annot-version=v1.0 MVKVSTYFAMTLGAFVFWQSMDKLHVWIALHQDEKVIIYQSTWLSSAESGFVI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G67785			unknown protein		Lus10042077 [exp]	0	1
AT3G01130			unknown protein		Lus10042059 [exp]	1.0	0.8999
AT1G68570			Major facilitator superfamily ...		Lus10018838 [exp]	5.3	0.8337
AT3G52390			TatD related DNase (.1.2)		Lus10013590 [exp]	6.9	0.8681
AT3G07570			Cytochrome b561/ferric reducta...		Lus10012305 [exp]	7.7	0.8334
AT3G18760			Translation elongation factor...		Lus10006729 [exp]	9.2	0.8658
AT4G17010			unknown protein		Lus10001160 [exp]	10.4	0.8675
AT2G40390			unknown protein		Lus10017423 [exp]	11.1	0.8135
AT3G52730			ubiquinol-cytochrome C reducta...		Lus10014198 [exp]	11.2	0.8601
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10008095 [exp]	12.4	0.8477
AT5G56710			Ribosomal protein L31e family ...		Lus10037703 [exp]	15.1	0.8719

Compare expression of checked genes

Lus10042077 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.