Lus10042079 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G10710 87 / 1e-20 PHS1 poor homologous synapsis 1 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018084 291 / 3e-101 AT1G10710 88 / 3e-20 poor homologous synapsis 1 (.1.2)
Lus10004624 73 / 1e-15 AT1G10710 170 / 4e-50 poor homologous synapsis 1 (.1.2)
Lus10026691 68 / 2e-14 AT1G10710 133 / 4e-38 poor homologous synapsis 1 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G044800 93 / 7e-23 AT1G10710 201 / 2e-62 poor homologous synapsis 1 (.1.2)
PFAM info
Representative CDS sequence
>Lus10042079 pacid=23153724 polypeptide=Lus10042079 locus=Lus10042079.g ID=Lus10042079.BGIv1.0 annot-version=v1.0
ATGGCGGGAATCAGTGAGCTGCCTCTTCTAAACCCTAACAATGGCACGAACAACACAGCTCAGACTCAGTGGTTGATACACTACGCTCGCTTCTTCAACC
TCCCTGCTCTCCAACCGACCTGCCCCGGTCTCGTTCCTCTGAGCTCCAGGTGGCGGAACAACAGTTCTTCCGGAACATGGCTCCCTTCTTCGTCCATGGT
GTCTCTGCAACTCCTTAGGCAACCGATTGACGCCGATGGTTTCCGCCTCGTCCTCCTCGTCTATTCTCAGGACAAAATCTACGAAGAACACTATATCTCG
AAGCTGCATTTCGCTTGGCCTCAGATTTCGTGTCTGGAAGCAACTTCTCTTAGAGGCAGCAGAGCTGTATTTGCAAGTTATGGAGATGGTCTAGGCCAGG
CAAGCTTTCTAACCTCTACAAGCTTGAATGGCATTGGAAATATAGGGATTGAAAGTGGCAGGTTTGTATCAGAACTCCCATCTACATCTCAGTTCATCTC
TCCAAATGGATCAGGTTACAGGTGA
AA sequence
>Lus10042079 pacid=23153724 polypeptide=Lus10042079 locus=Lus10042079.g ID=Lus10042079.BGIv1.0 annot-version=v1.0
MAGISELPLLNPNNGTNNTAQTQWLIHYARFFNLPALQPTCPGLVPLSSRWRNNSSSGTWLPSSSMVSLQLLRQPIDADGFRLVLLVYSQDKIYEEHYIS
KLHFAWPQISCLEATSLRGSRAVFASYGDGLGQASFLTSTSLNGIGNIGIESGRFVSELPSTSQFISPNGSGYR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G10710 PHS1 poor homologous synapsis 1 (.1... Lus10042079 0 1
AT4G31805 WRKY family transcription fact... Lus10024451 7.2 0.7897
AT4G02210 unknown protein Lus10027531 7.5 0.7537
AT1G79440 ENF1, SSADH1, A... SUCCINIC SEMIALDEHYDE DEHYDROG... Lus10002132 9.3 0.6914
Lus10031413 15.3 0.6936
Lus10020204 16.9 0.6497
AT5G41410 HD BEL1 BELL 1, POX (plant homeobox) f... Lus10024661 18.6 0.7549
Lus10015577 24.3 0.6678
AT2G22540 MADS AGL22, SVP SHORT VEGETATIVE PHASE, AGAMOU... Lus10025719 26.3 0.7471
AT1G62340 ALE1 ABNORMAL LEAF-SHAPE 1, ABNORMA... Lus10015559 27.5 0.7320
AT3G53180 NodGS nodulin/glutamine synthase-lik... Lus10023908 42.5 0.7387

Lus10042079 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.