Lus10042084 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G24670 189 / 9e-58 TAR2 tryptophan aminotransferase related 2 (.1.2)
AT1G23320 169 / 2e-50 TAR1 tryptophan aminotransferase related 1 (.1)
AT1G70560 160 / 6e-47 CKRC1, WEI8, TAA1, sav3 WEAK ETHYLENE INSENSITIVE 8, SHADE AVOIDANCE 3, cytokinin induced root curling 1, tryptophan aminotransferase of Arabidopsis 1 (.1)
AT1G34040 146 / 2e-41 ATMEPCT Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1)
AT1G34060 142 / 8e-40 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018088 299 / 1e-96 AT1G60780 632 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1)
Lus10039944 249 / 7e-81 AT4G24670 489 / 5e-172 tryptophan aminotransferase related 2 (.1.2)
Lus10027678 241 / 5e-79 AT4G24670 449 / 7e-158 tryptophan aminotransferase related 2 (.1.2)
Lus10006199 169 / 2e-50 AT1G70560 405 / 6e-141 WEAK ETHYLENE INSENSITIVE 8, SHADE AVOIDANCE 3, cytokinin induced root curling 1, tryptophan aminotransferase of Arabidopsis 1 (.1)
Lus10036846 162 / 1e-47 AT1G70560 415 / 4e-144 WEAK ETHYLENE INSENSITIVE 8, SHADE AVOIDANCE 3, cytokinin induced root curling 1, tryptophan aminotransferase of Arabidopsis 1 (.1)
Lus10028695 140 / 5e-39 AT1G34060 474 / 4e-165 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1)
Lus10007085 138 / 5e-38 AT1G34060 456 / 5e-158 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G083300 202 / 9e-63 AT4G24670 489 / 1e-171 tryptophan aminotransferase related 2 (.1.2)
Potri.T125108 202 / 1e-62 AT4G24670 487 / 7e-171 tryptophan aminotransferase related 2 (.1.2)
Potri.010G044500 164 / 9e-49 AT1G70560 504 / 4e-179 WEAK ETHYLENE INSENSITIVE 8, SHADE AVOIDANCE 3, cytokinin induced root curling 1, tryptophan aminotransferase of Arabidopsis 1 (.1)
Potri.008G187800 164 / 1e-48 AT1G70560 477 / 1e-168 WEAK ETHYLENE INSENSITIVE 8, SHADE AVOIDANCE 3, cytokinin induced root curling 1, tryptophan aminotransferase of Arabidopsis 1 (.1)
Potri.002G063800 139 / 2e-38 AT1G34060 472 / 1e-164 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1)
Potri.002G064000 135 / 4e-37 AT1G34060 514 / 0.0 Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0061 PLP_aminotran PF04864 Alliinase_C Allinase
Representative CDS sequence
>Lus10042084 pacid=23154020 polypeptide=Lus10042084 locus=Lus10042084.g ID=Lus10042084.BGIv1.0 annot-version=v1.0
ATGGGCCGGCGACGCCTCCAAATTCCAAGCGCACGGGCCCTTCGTGGAATTCGTAACTTCGCCCAACAACCCAGACGGGTTTACTCGACACCCGGTCGTG
AACCGAACGGAGGGTTTCTGGTTCACGATCTCGCTTACTACGGGCCGCAATACACCCCCGTGACTTCCCCTTCCGATCACGACATCACCCTTTTCACCGT
CTCCAAATCCACCGGCCACGCTGGCATCCGGATCGGATGGGCGCTGGTGAAGGATCCTGAGGTGGCGAGGAAAATGACGAAATTCATAGAGCTGAGCAGC
CTGGGGGTGTCCAAGGACTCGCAGCTGAGAGCAACCAAGATAATGGAGGTCGTTTCGGCGGATGCTGAGGAGGAATCCAAGCGGGTCTCATCGCTGTTCG
AGTTCGGGTTGAAGAACATGAAACGGCGGTGGAAGATGTTGAGAGCGGCGGTGAAAAAGAGCGGAGGAATGTTCAGCTTGCCGGATTACAGATCGGAGTT
CTGCAGTTTCAACGGCCAGTCCATGTCAAACCAACCCGCGTTTGCGTGGGTGAAGTGCGAGGGAGGAGACGTTGAAGACTGTGAAGAGGCGTTCAAGAAG
AATAAGATTGAGTCACTTTTAATATCTACATGGGATAATCATGCATTGTGGTTGATAAATCAGTACTACGTGTATTGTTTACTTTTAGTAAAATTTGGTG
ACTTACTGGTTAATTGA
AA sequence
>Lus10042084 pacid=23154020 polypeptide=Lus10042084 locus=Lus10042084.g ID=Lus10042084.BGIv1.0 annot-version=v1.0
MGRRRLQIPSARALRGIRNFAQQPRRVYSTPGREPNGGFLVHDLAYYGPQYTPVTSPSDHDITLFTVSKSTGHAGIRIGWALVKDPEVARKMTKFIELSS
LGVSKDSQLRATKIMEVVSADAEEESKRVSSLFEFGLKNMKRRWKMLRAAVKKSGGMFSLPDYRSEFCSFNGQSMSNQPAFAWVKCEGGDVEDCEEAFKK
NKIESLLISTWDNHALWLINQYYVYCLLLVKFGDLLVN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G24670 TAR2 tryptophan aminotransferase re... Lus10042084 0 1
AT1G17970 RING/U-box superfamily protein... Lus10021722 38.2 0.6656
AT5G55180 O-Glycosyl hydrolases family 1... Lus10029149 38.2 0.6852
AT1G60690 NAD(P)-linked oxidoreductase s... Lus10041303 67.2 0.6498
AT5G41620 unknown protein Lus10028746 180.7 0.6165
AT4G23180 RLK4, CRK10 cysteine-rich RLK (RECEPTOR-li... Lus10036314 181.5 0.6166
Lus10019251 186.0 0.5855

Lus10042084 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.