Lus10042085 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G24670 41 / 4e-05 TAR2 tryptophan aminotransferase related 2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018088 113 / 3e-30 AT1G60780 632 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1)
Lus10039944 56 / 3e-10 AT4G24670 489 / 5e-172 tryptophan aminotransferase related 2 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G083300 46 / 7e-07 AT4G24670 489 / 1e-171 tryptophan aminotransferase related 2 (.1.2)
Potri.T125108 43 / 1e-05 AT4G24670 487 / 7e-171 tryptophan aminotransferase related 2 (.1.2)
Potri.008G187800 41 / 6e-05 AT1G70560 477 / 1e-168 WEAK ETHYLENE INSENSITIVE 8, SHADE AVOIDANCE 3, cytokinin induced root curling 1, tryptophan aminotransferase of Arabidopsis 1 (.1)
Potri.010G044500 38 / 0.0006 AT1G70560 504 / 4e-179 WEAK ETHYLENE INSENSITIVE 8, SHADE AVOIDANCE 3, cytokinin induced root curling 1, tryptophan aminotransferase of Arabidopsis 1 (.1)
PFAM info
Representative CDS sequence
>Lus10042085 pacid=23153488 polypeptide=Lus10042085 locus=Lus10042085.g ID=Lus10042085.BGIv1.0 annot-version=v1.0
ATGGAAGGAGGTTATTTCAATGGTTTGTCGGCCAGTACTCACCTTCTGGTGTTGACGTTAACTCTGAACGTCAGCCTGCTCATCATTGCGTCCAGCCACC
GCATTGAGGTCGGTGCTTCTCTGGCGGCCGCCGTATCACCTCTCATAACCTCTCTATCTCAAGTGGAAGATGACGGCAGAATCATCAACCTTGACCTAGG
AGACCGGACAATGTTCGAGAAATTCTGGAAGGAAACGGCGGGGGACAGAGCCACTGTAGTGATCCAAGTTGGGAGTTCACTAGCTACTTCTCCGACTCCG
GCAGCATCTGCTGATTTCTTGAACCATGGCTAG
AA sequence
>Lus10042085 pacid=23153488 polypeptide=Lus10042085 locus=Lus10042085.g ID=Lus10042085.BGIv1.0 annot-version=v1.0
MEGGYFNGLSASTHLLVLTLTLNVSLLIIASSHRIEVGASLAAAVSPLITSLSQVEDDGRIINLDLGDRTMFEKFWKETAGDRATVVIQVGSSLATSPTP
AASADFLNHG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10042085 0 1
AT3G63480 ATP binding microtubule motor ... Lus10029983 10.0 0.7602
Lus10033923 13.3 0.8027
Lus10012012 14.7 0.7521
AT5G11280 unknown protein Lus10026797 21.6 0.7458
Lus10027007 24.0 0.7116
Lus10016269 27.2 0.7472
AT5G41610 ATCHX18 cation/H+ exchanger 18, ARABID... Lus10017541 32.9 0.7212
AT3G18200 nodulin MtN21 /EamA-like trans... Lus10021200 33.5 0.7280
AT2G02470 Alfin AL6 alfin-like 6 (.1.2) Lus10042404 35.9 0.7205
Lus10036784 36.5 0.7507

Lus10042085 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.