Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38360 82 / 3e-21 PRA1.B4 prenylated RAB acceptor 1.B4 (.1) AT3G56110 77 / 3e-19 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2) AT2G40380 77 / 4e-19 PRA1.B2 prenylated RAB acceptor 1.B2 (.1) AT5G01640 73 / 1e-17 PRA1.B5 prenylated RAB acceptor 1.B5 (.1) AT5G05380 70 / 1e-16 PRA1.B3 prenylated RAB acceptor 1.B3 (.1) AT5G07110 62 / 8e-14 PRA1.B6 prenylated RAB acceptor 1.B6 (.1) AT4G00005 38 / 6e-05 PRA1 (Prenylated rab acceptor) family protein (.1) AT3G13710 37 / 0.0003 PRA1.F4 prenylated RAB acceptor 1.F4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012224 [exp] 106 / 2e-30 AT2G38360 310 / 3e-108 prenylated RAB acceptor 1.B4 (.1) Lus10002853 [exp] 106 / 2e-30 AT2G38360 305 / 4e-106 prenylated RAB acceptor 1.B4 (.1) Lus10022680 [exp] 78 / 4e-20 AT2G38360 232 / 1e-78 prenylated RAB acceptor 1.B4 (.1) Lus10042246 [exp] 79 / 1e-19 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1) Lus10026404 [exp] 78 / 1e-19 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1) Lus10014234 [exp] 76 / 4e-19 AT2G38360 164 / 1e-51 prenylated RAB acceptor 1.B4 (.1) Lus10009842 [exp] 69 / 5e-16 AT2G38360 278 / 1e-95 prenylated RAB acceptor 1.B4 (.1) Lus10017425 [exp] 68 / 7e-16 AT2G38360 281 / 9e-97 prenylated RAB acceptor 1.B4 (.1) Lus10007533 [exp] 67 / 3e-15 AT2G38360 281 / 6e-97 prenylated RAB acceptor 1.B4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G074000 [exp] 87 / 5e-23 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2) Potri.008G074033 [exp] 87 / 5e-23 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2) Potri.010G183300 [exp] 84 / 4e-22 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2) Potri.006G104400 [exp] 76 / 7e-19 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1) Potri.016G126400 [exp] 76 / 1e-18 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1) Potri.019G124100 [exp] 61 / 2e-13 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1) Potri.002G043800 [exp] 44 / 6e-07 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.002G044000 [exp] 41 / 9e-06 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.005G219100 [exp] 40 / 1e-05 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.005G054700 [exp] 37 / 0.0002 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03208 [flax] [poplar] PRA1 PRA1 family protein
Representative CDS sequence Show only first row Show all	>Lus10042099 pacid=23153503 polypeptide=Lus10042099 locus=Lus10042099.g ID=Lus10042099.BGIv1.0 annot-version=v1.0 ATGGAGACGCTTGGGCTCCTCGCCTTGCTCAGCATCGTTGTCGTTTTCCTCACCAGCGTCGGATCCATCCTCATCTCTGGGCTCATGGTTGGAGCCGCCA TCGGTTGCGAGCACGGCGCGTTTAGAATTCCTGAGGATCTGTTTCTCGATGAGCAGGTGCCTGCCGCCGCTACTCTGCTTCGAACGTAG
AA sequence Show only first row Show all	>Lus10042099 pacid=23153503 polypeptide=Lus10042099 locus=Lus10042099.g ID=Lus10042099.BGIv1.0 annot-version=v1.0 METLGLLALLSIVVVFLTSVGSILISGLMVGAAIGCEHGAFRIPEDLFLDEQVPAAATLLRT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10042099 [exp]	0	1
AT4G35890			winged-helix DNA-binding trans...		Lus10025952 [exp]	3.7	0.6412
AT3G55400		OVA1	OVULE ABORTION 1, methionyl-tR...		Lus10001706 [exp]	5.8	0.6219
AT1G77610			EamA-like transporter family p...		Lus10018189 [exp]	22.4	0.6188
					Lus10041470 [exp]	28.3	0.6034
AT3G57570			ARM repeat superfamily protein...		Lus10026304 [exp]	38.7	0.5805
AT1G05020			ENTH/ANTH/VHS superfamily prot...		Lus10035340 [exp]	43.8	0.6058
AT1G58330		ZW2	transcription factor-related (...		Lus10028231 [exp]	50.2	0.5655
AT1G71160		KCS7	3-ketoacyl-CoA synthase 7 (.1)		Lus10029880 [exp]	73.3	0.5695
AT4G19985			Acyl-CoA N-acyltransferases (N...		Lus10003689 [exp]	82.5	0.5576
AT1G08710			F-box family protein (.1.2)		Lus10020340 [exp]	90.3	0.5175

Compare expression of checked genes

Lus10042099 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.