Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G63030 168 / 4e-55 GRXC1 glutaredoxin C1, Thioredoxin superfamily protein (.1) AT5G40370 153 / 3e-49 GRXC2 glutaredoxin C2, Glutaredoxin family protein (.1.2) AT2G20270 95 / 1e-25 Thioredoxin superfamily protein (.1.2) AT1G77370 92 / 9e-25 Glutaredoxin family protein (.1) AT5G20500 89 / 1e-23 Glutaredoxin family protein (.1) AT4G28730 86 / 6e-22 GrxC5 glutaredoxin C5, Glutaredoxin family protein (.1) AT5G18600 76 / 4e-19 Thioredoxin superfamily protein (.1) AT1G03020 71 / 7e-17 Thioredoxin superfamily protein (.1) AT3G62930 70 / 1e-16 Thioredoxin superfamily protein (.1) AT4G15670 69 / 4e-16 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001237 [exp] 231 / 7e-80 AT5G63030 171 / 2e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1) Lus10022253 [exp] 148 / 3e-47 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2) Lus10013089 [exp] 147 / 6e-47 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2) Lus10017148 [exp] 94 / 1e-25 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Lus10021590 [exp] 94 / 2e-25 AT5G20500 180 / 1e-59 Glutaredoxin family protein (.1) Lus10022844 [exp] 87 / 2e-22 AT4G28730 177 / 3e-57 glutaredoxin C5, Glutaredoxin family protein (.1) Lus10028355 [exp] 83 / 3e-21 AT1G77370 171 / 2e-56 Glutaredoxin family protein (.1) Lus10011333 [exp] 79 / 2e-19 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1) Lus10038514 [exp] 78 / 3e-19 AT5G14070 122 / 2e-36 Thioredoxin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G078900 [exp] 172 / 7e-57 AT5G63030 171 / 3e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1) Potri.012G082800 [exp] 164 / 2e-53 AT5G63030 155 / 6e-50 glutaredoxin C1, Thioredoxin superfamily protein (.1) Potri.001G347700 [exp] 142 / 6e-45 AT5G40370 158 / 1e-51 glutaredoxin C2, Glutaredoxin family protein (.1.2) Potri.002G254100 [exp] 96 / 8e-26 AT4G28730 176 / 2e-56 glutaredoxin C5, Glutaredoxin family protein (.1) Potri.018G133400 [exp] 89 / 7e-24 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Potri.007G017300 [exp] 86 / 2e-22 AT1G77370 163 / 8e-53 Glutaredoxin family protein (.1) Potri.001G060600 [exp] 82 / 3e-21 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1) Potri.003G167000 [exp] 82 / 8e-21 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1) Potri.001G325800 [exp] 76 / 9e-19 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1) Potri.008G214600 [exp] 74 / 2e-18 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00462 [flax] [poplar] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Lus10042104 pacid=23153716 polypeptide=Lus10042104 locus=Lus10042104.g ID=Lus10042104.BGIv1.0 annot-version=v1.0 ATGGGATCGCTGATGAGCTCGAGCAAGAAGATGAGCGAACAAGAAATGGATGCTGCCCTTAACAAGGCCAAGGAGATTTCCAAGTCCGCTCCTGTGGTTG TCTTCAGCAAAACTTATTGCGGGTTCTGCACGAGGGTGAAGCAGCTGCTGACCCAGCTTGGAGCTGCTTTTAAAGTCATCGAATTGGACAAAGAAAGTGA TGGAGACGAGATTCAAGGAGCGTTATTGAAATGGACGGGACAGAGGACAGTGCCTAATGTGTTCATCGGAGGGAAGCATATTGGTGGCTGCGACGCTACG TTGGCAAAGCACCAAAAGGGAGAGCTGCTTCCTCTTCTCACCGAGGTTGGCGCAGTAGCAAACAACGCTGCTCAGCTTTGA
AA sequence Show only first row Show all	>Lus10042104 pacid=23153716 polypeptide=Lus10042104 locus=Lus10042104.g ID=Lus10042104.BGIv1.0 annot-version=v1.0 MGSLMSSSKKMSEQEMDAALNKAKEISKSAPVVVFSKTYCGFCTRVKQLLTQLGAAFKVIELDKESDGDEIQGALLKWTGQRTVPNVFIGGKHIGGCDAT LAKHQKGELLPLLTEVGAVANNAAQL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G63030		GRXC1	glutaredoxin C1, Thioredoxin s...		Lus10042104 [exp]	0	1
AT2G30990			Protein of unknown function (D...		Lus10017644 [exp]	4.9	0.8962
AT5G26250			Major facilitator superfamily ...		Lus10002452 [exp]	5.8	0.8793
					Lus10034710 [exp]	6.0	0.8967
AT5G42510			Disease resistance-responsive ...		Lus10038298 [exp]	7.1	0.8702
AT1G68090		ANN5, ANNAT5	ANNEXIN ARABIDOPSIS THALIANA 5...		Lus10009225 [exp]	8.9	0.8906
AT2G20140		RPT2b	regulatory particle AAA-ATPase...		Lus10015524 [exp]	10.1	0.9016
AT2G38310		RCAR10, PYL4	regulatory components of ABA r...		Lus10022675 [exp]	10.8	0.8835
AT2G31800			Integrin-linked protein kinase...		Lus10027107 [exp]	10.8	0.8996
AT1G08110			lactoylglutathione lyase famil...		Lus10016138 [exp]	12.3	0.9033
AT3G23600			alpha/beta-Hydrolases superfam...		Lus10027997 [exp]	12.6	0.8613

Compare expression of checked genes

Lus10042104 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.