Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62940 149 / 7e-45 DOF AtDof5.6, HCA2 HIGH CAMBIAL ACTIVITY2, DNA BINDING WITH ONE FINGER 5.6, Dof-type zinc finger DNA-binding family protein (.1) AT1G64620 119 / 1e-33 DOF AtDof1,8 Dof-type zinc finger DNA-binding family protein (.1) AT4G24060 116 / 2e-32 DOF AtDof4,6 Dof-type zinc finger DNA-binding family protein (.1) AT5G60200 110 / 4e-31 DOF TMO6, AtDof5,3 TARGET OF MONOPTEROS 6 (.1) AT3G45610 108 / 1e-30 DOF DOF6, AtDof3,2 DOF transcription factor 6, Dof-type zinc finger DNA-binding family protein (.1) AT2G46590 108 / 1e-29 DOF DAG2, AtDof2,5 DOF AFFECTING GERMINATION 2, Dof-type zinc finger DNA-binding family protein (.1.2) AT3G55370 107 / 2e-29 DOF OBP3, AtDof3. 6 OBF-binding protein 3 (.1.2.3) AT2G37590 107 / 3e-29 DOF AtDof2. 4, ATDOF2.4 DNA binding with one finger 2.4 (.1) AT1G51700 103 / 4e-29 DOF ADOF1, AtDof1. 7 DOF zinc finger protein 1 (.1) AT3G61850 105 / 5e-29 DOF DAG1, AtDof3,7 dof affecting germination 1, Dof-type zinc finger DNA-binding family protein (.1.2.3.4)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002381 [exp] 229 / 2e-76 AT5G62940 166 / 4e-48 HIGH CAMBIAL ACTIVITY2, DNA BINDING WITH ONE FINGER 5.6, Dof-type zinc finger DNA-binding family protein (.1) Lus10016566 [exp] 109 / 6e-30 AT3G55370 160 / 2e-46 OBF-binding protein 3 (.1.2.3) Lus10014002 [exp] 105 / 3e-29 AT5G60200 124 / 7e-35 TARGET OF MONOPTEROS 6 (.1) Lus10033218 [exp] 107 / 4e-29 AT1G64620 169 / 7e-50 Dof-type zinc finger DNA-binding family protein (.1) Lus10017313 [exp] 106 / 6e-29 AT4G24060 171 / 8e-51 Dof-type zinc finger DNA-binding family protein (.1) Lus10025340 [exp] 107 / 8e-29 AT2G37590 182 / 4e-54 DNA binding with one finger 2.4 (.1) Lus10003207 [exp] 106 / 8e-29 AT4G24060 159 / 9e-46 Dof-type zinc finger DNA-binding family protein (.1) Lus10034652 [exp] 105 / 1e-28 AT5G60850 162 / 4e-48 OBF binding protein 4 (.1) Lus10040836 [exp] 102 / 1e-28 AT2G37590 142 / 2e-41 DNA binding with one finger 2.4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G081300 [exp] 166 / 5e-52 AT5G62940 194 / 3e-59 HIGH CAMBIAL ACTIVITY2, DNA BINDING WITH ONE FINGER 5.6, Dof-type zinc finger DNA-binding family protein (.1) Potri.015G077100 [exp] 163 / 4e-51 AT5G62940 191 / 4e-58 HIGH CAMBIAL ACTIVITY2, DNA BINDING WITH ONE FINGER 5.6, Dof-type zinc finger DNA-binding family protein (.1) Potri.001G086400 [exp] 124 / 3e-36 AT4G24060 176 / 5e-53 Dof-type zinc finger DNA-binding family protein (.1) Potri.003G144500 [exp] 122 / 2e-35 AT4G24060 201 / 1e-62 Dof-type zinc finger DNA-binding family protein (.1) Potri.015G009300 [exp] 120 / 9e-35 AT4G24060 154 / 1e-44 Dof-type zinc finger DNA-binding family protein (.1) Potri.012G018700 [exp] 120 / 2e-34 AT3G61850 141 / 9e-40 dof affecting germination 1, Dof-type zinc finger DNA-binding family protein (.1.2.3.4) Potri.002G174300 [exp] 110 / 8e-31 AT3G61850 229 / 8e-74 dof affecting germination 1, Dof-type zinc finger DNA-binding family protein (.1.2.3.4) Potri.007G058200 [exp] 111 / 1e-30 AT5G65590 192 / 1e-58 Dof-type zinc finger DNA-binding family protein (.1) Potri.015G048300 [exp] 110 / 2e-30 AT5G60850 152 / 1e-43 OBF binding protein 4 (.1) Potri.005G149100 [exp] 109 / 4e-30 AT5G65590 197 / 1e-60 Dof-type zinc finger DNA-binding family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02701 [flax] [poplar] zf-Dof Dof domain, zinc finger
Representative CDS sequence Show only first row Show all	>Lus10042114 pacid=23153866 polypeptide=Lus10042114 locus=Lus10042114.g ID=Lus10042114.BGIv1.0 annot-version=v1.0 ATGGGCCTTACTTCTCTCCAAGTCTGCATGGATTCACCTGCTGACTGGTTGCTCCAGGGGACAATGGCGGAGGACGTGGAGTCAGGACTGCTCGACCCCT CCAACGGTGGGGATATGCTGCTGGCTGCCTGCTCCAGACAACCAGCAGCAATGATGGAGAGGCGGTTGAGGCCGCCTCAAGACCAAGCACTAAAATGCCC TCGGTGTGAGTCTACCCACACCAAGTTCTGCTACTACAACAACTACAGCCTCACCCAGCCGCGCTACTTCTGCAAGACATGCCGAAGGTACTGGACGAAA GGCGGCACCCTTCGCAACATCCCCGTCGGGGGTGGCTGA
AA sequence Show only first row Show all	>Lus10042114 pacid=23153866 polypeptide=Lus10042114 locus=Lus10042114.g ID=Lus10042114.BGIv1.0 annot-version=v1.0 MGLTSLQVCMDSPADWLLQGTMAEDVESGLLDPSNGGDMLLAACSRQPAAMMERRLRPPQDQALKCPRCESTHTKFCYYNNYSLTQPRYFCKTCRRYWTK GGTLRNIPVGGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G62940	DOF	AtDof5.6, HCA2	HIGH CAMBIAL ACTIVITY2, DNA BI...		Lus10042114 [exp]	0	1
AT2G37590	DOF	AtDof2. 4, ATDO...	DNA binding with one finger 2....		Lus10040836 [exp]	2.2	0.7587
AT1G03840	C2H2ZnF	MGP	Magpie, C2H2 and C2HC zinc fin...		Lus10039869 [exp]	4.0	0.7469
					Lus10042115 [exp]	4.6	0.6947
AT1G71960		ATABCG25, ABCG2...	Arabidopsis thaliana ATP-bindi...		Lus10006046 [exp]	9.8	0.6256
AT5G60200	DOF	TMO6, AtDof5,3	TARGET OF MONOPTEROS 6 (.1)		Lus10015425 [exp]	10.8	0.6614
AT2G31960		ATGSL3, ATGSL03	glucan synthase-like 3 (.1.2)		Lus10037471 [exp]	13.0	0.7339
AT3G49760	bZIP	ATBZIP5	basic leucine-zipper 5 (.1)		Lus10011722 [exp]	15.1	0.7187
AT3G52490			Double Clp-N motif-containing ...		Lus10021291 [exp]	28.3	0.7109
AT5G17980			C2 calcium/lipid-binding plant...		Lus10010658 [exp]	30.1	0.7082
AT4G18340			Glycosyl hydrolase superfamily...		Lus10023309 [exp]	32.9	0.6435

Compare expression of checked genes

Lus10042114 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.