Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G10200 275 / 4e-95 LIM WLIM1, SF3 WLIM1, GATA type zinc finger transcription factor family protein (.1) AT2G39900 220 / 2e-73 LIM WLIM2a WLIM2a, GATA type zinc finger transcription factor family protein (.1) AT3G55770 218 / 2e-72 LIM WLIM2b WLIM2b, GATA type zinc finger transcription factor family protein (.1.2.3.4.5.6.7) AT1G01780 207 / 3e-68 LIM PLIM2b PLIM2b, GATA type zinc finger transcription factor family protein (.1) AT3G61230 206 / 6e-68 LIM PLIM2c PLIM2c, GATA type zinc finger transcription factor family protein (.1) AT2G45800 201 / 1e-65 LIM PLIM2a PLIM2a, GATA type zinc finger transcription factor family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004230 [exp] 376 / 2e-135 AT1G10200 281 / 1e-97 WLIM1, GATA type zinc finger transcription factor family protein (.1) Lus10043462 [exp] 320 / 1e-112 AT1G10200 260 / 2e-89 WLIM1, GATA type zinc finger transcription factor family protein (.1) Lus10034123 [exp] 298 / 9e-104 AT3G55770 244 / 1e-82 WLIM2b, GATA type zinc finger transcription factor family protein (.1.2.3.4.5.6.7) Lus10018674 [exp] 275 / 4e-95 AT1G10200 323 / 4e-114 WLIM1, GATA type zinc finger transcription factor family protein (.1) Lus10039010 [exp] 275 / 5e-95 AT1G10200 285 / 2e-99 WLIM1, GATA type zinc finger transcription factor family protein (.1) Lus10027305 [exp] 270 / 4e-93 AT1G10200 280 / 2e-97 WLIM1, GATA type zinc finger transcription factor family protein (.1) Lus10007748 [exp] 265 / 8e-91 AT1G10200 308 / 5e-108 WLIM1, GATA type zinc finger transcription factor family protein (.1) Lus10010455 [exp] 262 / 2e-90 AT1G10200 277 / 3e-96 WLIM1, GATA type zinc finger transcription factor family protein (.1) Lus10003822 [exp] 229 / 4e-74 AT3G03220 409 / 4e-143 EXPANSIN 13, expansin A13 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G072400 [exp] 331 / 2e-117 AT1G10200 277 / 5e-96 WLIM1, GATA type zinc finger transcription factor family protein (.1) Potri.012G077200 [exp] 330 / 7e-117 AT1G10200 268 / 2e-92 WLIM1, GATA type zinc finger transcription factor family protein (.1) Potri.001G292900 [exp] 293 / 2e-102 AT1G10200 317 / 9e-112 WLIM1, GATA type zinc finger transcription factor family protein (.1) Potri.009G087200 [exp] 291 / 2e-101 AT1G10200 316 / 2e-111 WLIM1, GATA type zinc finger transcription factor family protein (.1) Potri.002G118000 [exp] 278 / 1e-96 AT1G10200 325 / 7e-115 WLIM1, GATA type zinc finger transcription factor family protein (.1) Potri.014G015600 [exp] 278 / 2e-96 AT1G10200 327 / 8e-116 WLIM1, GATA type zinc finger transcription factor family protein (.1) Potri.010G193800 [exp] 227 / 3e-76 AT3G55770 323 / 2e-114 WLIM2b, GATA type zinc finger transcription factor family protein (.1.2.3.4.5.6.7) Potri.008G063600 [exp] 225 / 2e-75 AT3G55770 324 / 1e-114 WLIM2b, GATA type zinc finger transcription factor family protein (.1.2.3.4.5.6.7) Potri.003G124300 [exp] 210 / 2e-69 AT3G61230 264 / 2e-90 PLIM2c, GATA type zinc finger transcription factor family protein (.1) Potri.001G107100 [exp] 209 / 7e-69 AT3G61230 256 / 6e-87 PLIM2c, GATA type zinc finger transcription factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF00412 [flax] [poplar] LIM LIM domain
Representative CDS sequence Show only first row Show all	>Lus10042140 pacid=23153469 polypeptide=Lus10042140 locus=Lus10042140.g ID=Lus10042140.BGIv1.0 annot-version=v1.0 ATGGCGACTTTTGCAGGGACGACCCAGAAGTGCAAAGCTTGCGAGAAGACCGTTTACTTGGTGGATCAGCTCACCGCCGACAACAAAGTCTTCCATAAAG CTTGCTTCCGATGTCACCACTGCAAGGGCACCCTCAAGCTGAGCAACTACAGCTCATTTGAGGGTGTCTTGTATTGCAAGCCTCACTTTGATCAGCTGTT CAAGATGACTGGCAGCTTGGATAAAAGTTTTGAAGGAACTCCCAAGACTGTAAGGGTGGAAAGATCCGCTGATCAGAATAGCAACAGCAAAATCTCAAGT ATGTTTGCTGGTACTCAAGACAAGTGTGTTGCTTGCAAGAAAACCGTTTACCCTATCGAAAAGGTGGCAGTAGATGGCACATCATACCACAAGCCATGCT TCAGGTGCAGCCATGGCGGCTGCGTGATAAGCCCATCGAACTACGTAGCTCATGATCAGCGCCTCTACTGCAGACACCACCACACCCAACTCTTCAAGGA AAAGGGCAACTTCAGCCAACTTAGCAAGCACGAAAATGGCAAAGCAGTTGCTGCTGCAACCGATGCTGTTGCGGAATGA
AA sequence Show only first row Show all	>Lus10042140 pacid=23153469 polypeptide=Lus10042140 locus=Lus10042140.g ID=Lus10042140.BGIv1.0 annot-version=v1.0 MATFAGTTQKCKACEKTVYLVDQLTADNKVFHKACFRCHHCKGTLKLSNYSSFEGVLYCKPHFDQLFKMTGSLDKSFEGTPKTVRVERSADQNSNSKISS MFAGTQDKCVACKKTVYPIEKVAVDGTSYHKPCFRCSHGGCVISPSNYVAHDQRLYCRHHHTQLFKEKGNFSQLSKHENGKAVAAATDAVAE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G10200	LIM	WLIM1, SF3	WLIM1, GATA type zinc finger t...		Lus10042140 [exp]	0	1
AT1G10200	LIM	WLIM1, SF3	WLIM1, GATA type zinc finger t...		Lus10004230 [exp]	1.0	0.8073
AT4G14010		RALFL32	ralf-like 32 (.1)		Lus10008885 [exp]	6.3	0.7113
AT4G17890		UBP20, AGD8	ARF-GAP domain 8 (.1.2)		Lus10004562 [exp]	10.5	0.6957
AT3G52770		ZPR3	LITTLE ZIPPER 3, protein bindi...		Lus10022725 [exp]	11.7	0.7392
AT5G02440			unknown protein		Lus10016560 [exp]	21.0	0.6591
AT1G04360			RING/U-box superfamily protein...		Lus10000710 [exp]	36.9	0.6724
AT4G35020		ROP6, ARAC3, RH...	RHO-RELATED PROTEIN FROM PLANT...		Lus10014123 [exp]	52.5	0.6805
AT1G10750			Protein of Unknown Function (D...		Lus10029116 [exp]	80.9	0.6364
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10030456 [exp]	94.6	0.6571
AT1G04360			RING/U-box superfamily protein...		Lus10024881 [exp]	105.0	0.6257

Compare expression of checked genes

Lus10042140 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.