Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G48140 132 / 6e-42 B12D protein (.1) AT3G29970 101 / 1e-29 B12D protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004241 [exp] 183 / 4e-62 AT3G48140 132 / 4e-42 B12D protein (.1) Lus10015825 [exp] 132 / 8e-42 AT3G48140 150 / 3e-49 B12D protein (.1) Lus10036977 [exp] 120 / 6e-37 AT3G48140 132 / 9e-42 B12D protein (.1) Lus10035132 [exp] 99 / 7e-29 AT3G29970 112 / 5e-34 B12D protein (.1) Lus10031971 [exp] 49 / 4e-08 AT5G60335 152 / 5e-47 Thioesterase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G074900 [exp] 158 / 3e-52 AT3G48140 137 / 8e-44 B12D protein (.1) Potri.008G179401 [exp] 147 / 8e-48 AT3G48140 137 / 8e-44 B12D protein (.1) Potri.010G055300 [exp] 142 / 3e-45 AT3G48140 132 / 8e-41 B12D protein (.1) Potri.017G098800 [exp] 108 / 1e-32 AT3G29970 131 / 9e-42 B12D protein (.1) Potri.004G117300 [exp] 103 / 1e-30 AT3G29970 126 / 9e-40 B12D protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06522 [flax] [poplar] B12D NADH-ubiquinone reductase complex 1 MLRQ subunit
Representative CDS sequence Show only first row Show all	>Lus10042151 pacid=23153748 polypeptide=Lus10042151 locus=Lus10042151.g ID=Lus10042151.BGIv1.0 annot-version=v1.0 ATGGCCGGAAATCGGTGGTTGAGGCCTGAGGTGTATCCTCTTTTCGCCGCTGTGGGAGCTGCTGTAGGGATCTGCGGGTTTCAGCTTGTTCGCAACATCT GCATCAACCCTGAAGTCAGGGTGAAGAAGGATAACAGAACTGCAGGAATTCTGGACAACTTCGCTGAAGGAGAGAAATATTCAGAGCATTACATCAGGAA GCTAGTACGGAACAGGTCACCTGAGATCATGCCTTCCCTCAACGGCTTCTTCTCCAACCCTAAGTGA
AA sequence Show only first row Show all	>Lus10042151 pacid=23153748 polypeptide=Lus10042151 locus=Lus10042151.g ID=Lus10042151.BGIv1.0 annot-version=v1.0 MAGNRWLRPEVYPLFAAVGAAVGICGFQLVRNICINPEVRVKKDNRTAGILDNFAEGEKYSEHYIRKLVRNRSPEIMPSLNGFFSNPK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G48140			B12D protein (.1)		Lus10042151 [exp]	0	1
AT3G48140			B12D protein (.1)		Lus10004241 [exp]	1.0	0.9692
AT1G73177		APC13, BNS	anaphase-promoting complex 13,...		Lus10007286 [exp]	2.8	0.9318
AT1G28490		OSM1, ATSYP61, ...	syntaxin of plants 61 (.1.2)		Lus10017686 [exp]	4.6	0.9363
AT1G64750		DSS1(I), ATDSS1...	deletion of SUV3 suppressor 1(...		Lus10030906 [exp]	4.8	0.9031
AT3G18620			DHHC-type zinc finger family p...		Lus10013426 [exp]	5.3	0.9383
AT3G22845			emp24/gp25L/p24 family/GOLD fa...		Lus10039381 [exp]	5.5	0.9310
AT2G04900			unknown protein		Lus10001166 [exp]	5.6	0.8939
AT5G20090			Uncharacterised protein family...		Lus10025851 [exp]	5.7	0.9222
AT5G27720		LSM4, EMB1644	SM-like protein 4, embryo defe...		Lus10029426 [exp]	5.7	0.9204
AT5G58740			HSP20-like chaperones superfam...		Lus10018234 [exp]	5.9	0.9236

Compare expression of checked genes

Lus10042151 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.