Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19000 207 / 5e-67 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G19010 185 / 5e-58 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT4G10500 84 / 6e-19 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 83 / 1e-18 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G51810 82 / 5e-18 AT2353, GA20OX2, ATGA20OX2 gibberellin 20 oxidase 2 (.1) AT3G21420 81 / 9e-18 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G51240 80 / 9e-18 TT6, F3'H, F3H TRANSPARENT TESTA 6, flavanone 3-hydroxylase (.1.2) AT5G24530 80 / 2e-17 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G60980 80 / 3e-17 ATGA20OX4 gibberellin 20-oxidase 4 (.1) AT4G25420 79 / 6e-17 AT2301, GA5, ATGA20OX1 GA REQUIRING 5, ARABIDOPSIS THALIANA GIBBERELLIN 20-OXIDASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023851 [exp] 216 / 2e-69 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10020999 [exp] 209 / 1e-66 AT3G19000 473 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004245 [exp] 195 / 6e-62 AT3G19010 277 / 2e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Lus10021002 [exp] 169 / 6e-51 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10023850 [exp] 96 / 3e-24 AT3G19000 225 / 4e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10041913 [exp] 89 / 2e-20 AT3G51240 602 / 0.0 TRANSPARENT TESTA 6, flavanone 3-hydroxylase (.1.2) Lus10027807 [exp] 85 / 2e-19 AT5G05600 330 / 1e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10040112 [exp] 84 / 7e-19 AT1G17020 332 / 1e-112 senescence-related gene 1 (.1) Lus10030995 [exp] 84 / 1e-18 AT1G17020 339 / 2e-115 senescence-related gene 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G107600 [exp] 219 / 1e-70 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107550 [exp] 216 / 2e-69 AT3G19000 452 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146100 [exp] 180 / 3e-55 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146000 [exp] 179 / 1e-54 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.011G151000 [exp] 86 / 9e-20 AT4G10500 287 / 2e-95 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G113900 [exp] 86 / 2e-19 AT3G51240 598 / 0.0 TRANSPARENT TESTA 6, flavanone 3-hydroxylase (.1.2) Potri.005G113700 [exp] 85 / 3e-19 AT3G51240 590 / 0.0 TRANSPARENT TESTA 6, flavanone 3-hydroxylase (.1.2) Potri.006G101200 [exp] 84 / 9e-19 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G023600 [exp] 82 / 3e-18 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G101100 [exp] 82 / 5e-18 AT5G05600 462 / 1e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10042155 pacid=23154035 polypeptide=Lus10042155 locus=Lus10042155.g ID=Lus10042155.BGIv1.0 annot-version=v1.0 ATGGCCTCAGGCCATCCACAAGAGCTACAAGTTCCGGTGATCGACCTGGCTAGAGACATTGAGGTGGTGGTGGAGGAAGTGAAGAATGCTTGTAGAGGAG TTCTTGGCCCCGGAGGAGAAGAAGTGAATCCGTTGGGGTACCATGATAGTGAACATACCAAGAACGTTAGAGATTGGAAGGAAGTCTTTGATTTCTTGGT CATGGAACCCAACTTCATCCCTGCTTCTCCTGACTTGGACTGTGATGAACTGAGAATCATTCGGAATCCATGGCCTGCTTCTCCATCTCAGTTCAGGGCT GTGCGAGAGGAATATGCAGGAGAAATGGAGAAACTAGCGTTGAAGCTCATAGAAATAATCTCCCTGAGCTTAGGATTGCCTGCTGATAGGCTAAACAAAT ACTTTGAGAATCAGATCAGCTTTGTTAGGATCAATCACTACCCACCTTTCCCATTTCCTGACTTGACTACTACTCTGGGCTGTGGTCGACACAAGGATCC TGAAGCGCTCACCATTTCGGCTCAGGATAGTATTGGAGGGCTCGAGATTAGGAGCAACTCCAGTGGTCAGTGGGTTCCTGTCACACACATTCTCGACGCA TTCATCATCAACGTCGGCGAGATTTGTCAGGTTAGCGTACCCAAAACAAAAAATTTATGTGATCAAAAATCATAG
AA sequence Show only first row Show all	>Lus10042155 pacid=23154035 polypeptide=Lus10042155 locus=Lus10042155.g ID=Lus10042155.BGIv1.0 annot-version=v1.0 MASGHPQELQVPVIDLARDIEVVVEEVKNACRGVLGPGGEEVNPLGYHDSEHTKNVRDWKEVFDFLVMEPNFIPASPDLDCDELRIIRNPWPASPSQFRA VREEYAGEMEKLALKLIEIISLSLGLPADRLNKYFENQISFVRINHYPPFPFPDLTTTLGCGRHKDPEALTISAQDSIGGLEIRSNSSGQWVPVTHILDA FIINVGEICQVSVPKTKNLCDQKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Lus10042155 [exp]	0	1
AT5G06570			alpha/beta-Hydrolases superfam...		Lus10008441 [exp]	3.5	0.9542
AT4G23310		CRK23	cysteine-rich RLK (RECEPTOR-li...		Lus10009583 [exp]	4.9	0.9512
					Lus10041400 [exp]	5.5	0.8508
					Lus10033901 [exp]	5.7	0.9458
AT5G58980			Neutral/alkaline non-lysosomal...		Lus10021829 [exp]	6.9	0.9439
AT4G31920	GARP	ARR10	response regulator 10 (.1)		Lus10025044 [exp]	8.7	0.9417
AT1G65590		HEXO3, ATHEX1	beta-hexosaminidase 3 (.1)		Lus10022251 [exp]	9.0	0.9270
AT5G52170	HD	HDG7	homeodomain GLABROUS 7 (.1)		Lus10035095 [exp]	9.5	0.9416
AT1G71530			Protein kinase superfamily pro...		Lus10001470 [exp]	10.6	0.9393
AT1G68310		AE7	AS1/2 ENHANCER7, Protein of un...		Lus10031007 [exp]	12.0	0.9327

Compare expression of checked genes

Lus10042155 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.