Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004247 [exp] 100 / 6e-30 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G074300 [exp] 81 / 3e-22 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042157 pacid=23153803 polypeptide=Lus10042157 locus=Lus10042157.g ID=Lus10042157.BGIv1.0 annot-version=v1.0 ATGGGAATAGGAAGCAAAGCTGCCGACTGGACATTCAAGGGCTTCACGGCGGCTCTCGGCGTCGCCACCATATACCTAACCGCCACTTTCTCCGTCAACG TCTACCGCGGCCTCTCCTGGCACAAGGCCCAATCGGTAACCCTAAAGCCCTTACCTTACTGCTCTTCGATTGAATTTTTAATTCTGTCACCAGTGATAGT CCTTTGTTTCCTCTAA
AA sequence Show only first row Show all	>Lus10042157 pacid=23153803 polypeptide=Lus10042157 locus=Lus10042157.g ID=Lus10042157.BGIv1.0 annot-version=v1.0 MGIGSKAADWTFKGFTAALGVATIYLTATFSVNVYRGLSWHKAQSVTLKPLPYCSSIEFLILSPVIVLCFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10042157 [exp]	0	1
					Lus10004247 [exp]	1.0	0.8584
AT2G31490			unknown protein		Lus10027603 [exp]	6.0	0.7632
AT3G05070			unknown protein		Lus10042290 [exp]	19.8	0.7465
AT1G49170			Protein of unknown function (D...		Lus10020853 [exp]	22.1	0.6977
AT5G41010		NRPE12, NRPD12,...	DNA directed RNA polymerase, 7...		Lus10007891 [exp]	30.5	0.7080
AT1G69960		PP2A	serine/threonine protein phosp...		Lus10004252 [exp]	30.9	0.7108
AT3G48425			DNAse I-like superfamily prote...		Lus10043333 [exp]	31.0	0.6999
AT3G18510			unknown protein		Lus10042971 [exp]	37.9	0.7050
AT1G22950			2-oxoglutarate (2OG) and Fe(II...		Lus10000171 [exp]	39.2	0.6680
AT5G66200		ARO2	armadillo repeat only 2 (.1)		Lus10036897 [exp]	40.3	0.6826

Compare expression of checked genes

Lus10042157 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.