Lus10042175 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10042175 pacid=23153706 polypeptide=Lus10042175 locus=Lus10042175.g ID=Lus10042175.BGIv1.0 annot-version=v1.0
ATGTCCGTATCTGTTCGAGAGTCCAGAAGGTTCTTTGTCGAGAAGAAAAAAAGGGTCGGGAAGGCGGCGAAGAAAGCGAGAGCAGGGTCCCTCTTCGTCG
GAGCGGGCCCTGCTCCGCTTAGTAGCGGCGGCGAGGGTCATTGTCCGGCGGATTTCCGTTTCCCAGCTGCTTCAGTTCAAAAGTTTGCAAGGAGGGAAGT
TGCACAAGGTGTTCGAGCATGGCGTGTGTTCTCACAGTGCGACCCAATTGCTCAACCACATTTACCTCTTTCGCAACAAAATGCCAGAGTGCCCCGCAAT
GCCCTTGGAGAGAACCAGGAGTGA
AA sequence
>Lus10042175 pacid=23153706 polypeptide=Lus10042175 locus=Lus10042175.g ID=Lus10042175.BGIv1.0 annot-version=v1.0
MSVSVRESRRFFVEKKKRVGKAAKKARAGSLFVGAGPAPLSSGGEGHCPADFRFPAASVQKFARREVAQGVRAWRVFSQCDPIAQPHLPLSQQNARVPRN
ALGENQE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10042175 0 1
AT1G13290 C2H2ZnF WIP6, DOT5 WIP domain protein 6, DEFECTIV... Lus10035044 2.2 0.7215
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10027430 15.2 0.6336
Lus10039750 20.8 0.6175
AT1G67590 Remorin family protein (.1.2) Lus10036996 22.1 0.6775
AT1G04110 SDD1 STOMATAL DENSITY AND DISTRIBUT... Lus10006702 22.5 0.5806
AT1G11000 ATMLO4, MLO4 MILDEW RESISTANCE LOCUS O 4, S... Lus10012698 22.6 0.6210
Lus10005187 22.8 0.6075
Lus10002152 23.6 0.6075
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Lus10025408 24.3 0.6075
Lus10010117 25.1 0.6075

Lus10042175 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.