Lus10042178 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G62750 41 / 2e-05 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004267 82 / 2e-21 AT5G62750 56 / 5e-11 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G064900 41 / 1e-05 ND /
PFAM info
Representative CDS sequence
>Lus10042178 pacid=23154040 polypeptide=Lus10042178 locus=Lus10042178.g ID=Lus10042178.BGIv1.0 annot-version=v1.0
ATGGGAGGAACAGAAGAGACGGAGAAGAAGTACGACGGTGGCGAAGAGGAAGAACACCACAAGAAGAAGAAGGACAAGGATCATGAGGAGCAGTCCGGGG
AGAAATCCAAGGAGAAGAAGGACAAGAAGAAGAAAGACAAAGAAGGTAAGAATAAGGAGGGTGATGATGACGGCCACAAGGAGAAGAAGAAGAAGAACCC
TGAAGACAAGAATGACCCTGCTAAACTCAAGGCTAAACTGCAGAAGATCGAAACCCAGATGCAGGAATTGACCCTGAAGAAAGAAGACATCCTTAAACGA
ATCCACGAAGCTGAATCTAACCCTCCTCCCCCGTCCGAGTAA
AA sequence
>Lus10042178 pacid=23154040 polypeptide=Lus10042178 locus=Lus10042178.g ID=Lus10042178.BGIv1.0 annot-version=v1.0
MGGTEETEKKYDGGEEEEHHKKKKDKDHEEQSGEKSKEKKDKKKKDKEGKNKEGDDDGHKEKKKKNPEDKNDPAKLKAKLQKIETQMQELTLKKEDILKR
IHEAESNPPPPSE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G62750 unknown protein Lus10042178 0 1
AT2G36530 ENO2, LOS2 LOW EXPRESSION OF OSMOTICALLY ... Lus10015028 1.0 0.9818
AT5G25940 early nodulin-related (.1) Lus10030052 6.8 0.9621
AT1G76680 OPR1, ATOPR1 ARABIDOPSIS 12-OXOPHYTODIENOAT... Lus10001275 10.6 0.9524
AT1G72360 AP2_ERF AtERF73, HRE1 HYPOXIA RESPONSIVE ERF \(ETHYL... Lus10008214 12.0 0.9606
AT3G50390 Transducin/WD40 repeat-like su... Lus10016779 12.0 0.9600
AT3G48660 Protein of unknown function (D... Lus10003120 12.6 0.9600
AT3G05550 Hypoxia-responsive family prot... Lus10033002 13.5 0.9465
AT3G10920 MSD1, MEE33, AT... MATERNAL EFFECT EMBRYO ARREST ... Lus10030534 14.5 0.9567
AT4G10265 Wound-responsive family protei... Lus10031613 17.4 0.9133
Lus10002596 17.7 0.9566

Lus10042178 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.