Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G26880 182 / 5e-61 Ribosomal protein L34e superfamily protein (.1.2) AT1G69620 180 / 5e-60 RPL34 ribosomal protein L34 (.1) AT3G28900 177 / 8e-59 Ribosomal protein L34e superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037177 [exp] 191 / 2e-64 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10012829 [exp] 191 / 3e-64 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10030477 [exp] 191 / 3e-64 AT1G26880 219 / 2e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10036750 [exp] 189 / 9e-64 AT1G26880 217 / 8e-75 Ribosomal protein L34e superfamily protein (.1.2) Lus10008617 [exp] 189 / 2e-63 AT1G26880 215 / 8e-74 Ribosomal protein L34e superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G082200 [exp] 186 / 1e-62 AT1G26880 187 / 7e-63 Ribosomal protein L34e superfamily protein (.1.2) Potri.012G108400 [exp] 186 / 2e-62 AT1G26880 187 / 7e-63 Ribosomal protein L34e superfamily protein (.1.2) Potri.015G106466 [exp] 186 / 2e-62 AT1G26880 187 / 1e-62 Ribosomal protein L34e superfamily protein (.1.2) Potri.015G106532 [exp] 186 / 2e-62 AT1G26880 187 / 1e-62 Ribosomal protein L34e superfamily protein (.1.2) Potri.001G195101 [exp] 177 / 5e-59 AT1G26880 178 / 3e-59 Ribosomal protein L34e superfamily protein (.1.2) Potri.004G029400 [exp] 165 / 1e-53 AT1G26880 168 / 6e-55 Ribosomal protein L34e superfamily protein (.1.2) Potri.012G108301 [exp] 107 / 1e-31 AT1G26880 105 / 3e-31 Ribosomal protein L34e superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01199 [flax] [poplar] Ribosomal_L34e Ribosomal protein L34e
Representative CDS sequence Show only first row Show all	>Lus10042199 pacid=23153754 polypeptide=Lus10042199 locus=Lus10042199.g ID=Lus10042199.BGIv1.0 annot-version=v1.0 ATGGTGCAGCGACTCACTTACCGTAAGCGCCATAGCTATGCCACCAAGTCCAATCAGCACCGAATTGTCAAGACTCCAGGTGGTAAGCTTGTGTACCAGA CCACCAAGAAGCGAGCCAGTGGACCTAAATGTCCAGTTACTGGAAAGAGGATTCAAGGGATTCCACACTTGAGGCCTGCTGAATACAAGAGATCTAGGCT ACCGAGGAACAGGAGGACAGTGAACCGAGCTTACGGTGGTGTCTTGTCTGGAGGAGCTGTAAGGGAGAGGATCATTAGGGCATTTTTGGTTGAAGAGCAA AAGATTGTGAAGAAGGTGCTCAAGATTCAGAAGTCAAAGGAAAAGACCACAAAAGCCTAG
AA sequence Show only first row Show all	>Lus10042199 pacid=23153754 polypeptide=Lus10042199 locus=Lus10042199.g ID=Lus10042199.BGIv1.0 annot-version=v1.0 MVQRLTYRKRHSYATKSNQHRIVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLPRNRRTVNRAYGGVLSGGAVRERIIRAFLVEEQ KIVKKVLKIQKSKEKTTKA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G26880			Ribosomal protein L34e superfa...		Lus10042199 [exp]	0	1
AT3G10090			Nucleic acid-binding, OB-fold-...		Lus10029320 [exp]	1.0	0.8970
AT1G69960		PP2A	serine/threonine protein phosp...		Lus10004252 [exp]	1.7	0.8843
AT3G23620			Ribosomal RNA processing Brix ...		Lus10027714 [exp]	3.2	0.8855
AT3G08000			RNA-binding (RRM/RBD/RNP motif...		Lus10015146 [exp]	4.0	0.8322
AT4G30220		RUXF	small nuclear ribonucleoprotei...		Lus10006867 [exp]	4.5	0.8675
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Lus10033907 [exp]	4.6	0.8583
AT1G07840			Sas10/Utp3/C1D family (.1.2.3)		Lus10029397 [exp]	6.0	0.8553
AT3G10950			Zinc-binding ribosomal protein...		Lus10011359 [exp]	7.7	0.8339
AT1G20430			unknown protein		Lus10034561 [exp]	8.8	0.8375
AT3G18760			Translation elongation factor...		Lus10038301 [exp]	8.9	0.8662

Compare expression of checked genes

Lus10042199 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.