Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G08685 165 / 8e-53 SAH7 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 127 / 6e-38 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT5G10130 103 / 9e-29 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 84 / 8e-21 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G29140 83 / 1e-20 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 82 / 3e-20 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G09925 38 / 0.0008 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G15780 39 / 0.001 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008615 [exp] 290 / 4e-102 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10041707 [exp] 139 / 2e-42 AT5G10130 150 / 9e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10026040 [exp] 136 / 3e-41 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10014332 [exp] 128 / 2e-38 AT5G10130 154 / 2e-48 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10028134 [exp] 105 / 4e-29 AT1G29140 118 / 4e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013681 [exp] 104 / 7e-29 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042838 [exp] 102 / 3e-28 AT1G29140 115 / 6e-33 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017940 [exp] 102 / 7e-28 AT1G29140 117 / 8e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10018131 [exp] 101 / 2e-27 AT1G29140 118 / 5e-34 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G167900 [exp] 184 / 2e-60 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G093100 [exp] 181 / 3e-59 AT4G08685 199 / 3e-66 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.007G090100 [exp] 133 / 2e-40 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G078200 [exp] 132 / 4e-40 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G111300 [exp] 118 / 3e-34 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G392400 [exp] 104 / 6e-29 AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G060500 [exp] 44 / 1e-05 AT5G13140 185 / 3e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 43 / 3e-05 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G326200 [exp] 42 / 3e-05 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 42 / 5e-05 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10042201 pacid=23154036 polypeptide=Lus10042201 locus=Lus10042201.g ID=Lus10042201.BGIv1.0 annot-version=v1.0 ATGGCTCCTCGATTCTTGCTCTTCGTTGCTCTCTCCGTCCTCCTCGCCGCTCTCGTCTCCGATGCCCGCCCTGCTAAGGACCCGTTCCTCGTCCGCGGCA AGGTCTACTGCGACACCTGCAACTTCGGCTTCGAAACCCCCAAATCCACTTCCATTCCTGGTGCTACGGTGAAGATTCAGTGCAGGAACAGGAAAAGCAA CGAGCTGGTTTACGAAAGAGAAGGGGAGACTAATTCGGAAGGGATGTACGAGATCCACGTGGACGAAGACCACATGGACCAAGTGTGCGATGCCAAGGTG GTCAACAGCCCGCAGCTCGACTGCTTCAAGCCGTCTGCAGGACGCGATCAGGCACGCGTGATCCTGACTGATTCGAACGGCATTGTGAGCAAGGTTCGGT TTGCGAATGCCATGGGGTTTTCCAAGGAAGGAACTGTTGACGGTTGCTCCCAGCTTCTCAGCCTTTACCAGGAGACTGATGATTAG
AA sequence Show only first row Show all	>Lus10042201 pacid=23154036 polypeptide=Lus10042201 locus=Lus10042201.g ID=Lus10042201.BGIv1.0 annot-version=v1.0 MAPRFLLFVALSVLLAALVSDARPAKDPFLVRGKVYCDTCNFGFETPKSTSIPGATVKIQCRNRKSNELVYEREGETNSEGMYEIHVDEDHMDQVCDAKV VNSPQLDCFKPSAGRDQARVILTDSNGIVSKVRFANAMGFSKEGTVDGCSQLLSLYQETDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G08685		SAH7	Pollen Ole e 1 allergen and ex...		Lus10042201 [exp]	0	1
AT5G07720			Galactosyl transferase GMA12/M...		Lus10000563 [exp]	1.0	0.9394
AT1G50010		TUA2	tubulin alpha-2 chain (.1)		Lus10035422 [exp]	2.4	0.9071
AT5G12250		TUB6	beta-6 tubulin (.1)		Lus10026813 [exp]	2.4	0.9019
AT5G15350		AtENODL17	early nodulin-like protein 17 ...		Lus10005231 [exp]	2.8	0.8722
AT1G70090		GATL9, LGT8	GALACTURONOSYLTRANSFERASE-LIKE...		Lus10030821 [exp]	3.2	0.8914
AT3G05520			Subunits of heterodimeric acti...		Lus10020651 [exp]	5.5	0.8256
AT1G27970		NTF2B	nuclear transport factor 2B (....		Lus10037033 [exp]	5.9	0.8796
AT4G37450		ATAGP18, AGP18	arabinogalactan protein 18 (....		Lus10011520 [exp]	7.7	0.8487
AT1G50010		TUA2	tubulin alpha-2 chain (.1)		Lus10031032 [exp]	8.0	0.8917
AT3G46550		FLA4, SOS5	salt overly sensitive 5, fasci...		Lus10016554 [exp]	10.8	0.8685

Compare expression of checked genes

Lus10042201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.