Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74670 130 / 5e-41 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT5G15230 114 / 3e-34 GASA4 GAST1 protein homolog 4 (.1.2) AT3G10185 84 / 2e-22 Gibberellin-regulated family protein (.1) AT2G30810 80 / 7e-21 Gibberellin-regulated family protein (.1) AT3G02885 78 / 2e-20 GASA5 GAST1 protein homolog 5 (.1) AT2G39540 68 / 2e-16 Gibberellin-regulated family protein (.1) AT1G10588 67 / 6e-16 Gibberellin-regulated family protein (.1.2) AT1G22690 64 / 1e-14 Gibberellin-regulated family protein (.1.2.3) AT5G59845 63 / 2e-14 Gibberellin-regulated family protein (.1) AT4G09600 62 / 6e-14 GASA3 GAST1 protein homolog 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008612 [exp] 162 / 2e-53 AT1G74670 138 / 8e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10002059 [exp] 147 / 2e-47 AT1G74670 132 / 1e-41 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10030680 [exp] 117 / 9e-36 AT5G15230 131 / 5e-41 GAST1 protein homolog 4 (.1.2) Lus10024216 [exp] 118 / 1e-35 AT1G74670 106 / 1e-30 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10018016 [exp] 103 / 8e-30 AT1G74670 110 / 2e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10029340 [exp] 100 / 7e-29 AT2G30810 108 / 3e-32 Gibberellin-regulated family protein (.1) Lus10005241 [exp] 100 / 1e-28 ND 96 / 4e-27 Lus10004048 [exp] 95 / 1e-26 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10042012 [exp] 92 / 1e-25 AT1G74670 96 / 6e-27 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G083000 [exp] 113 / 4e-34 AT5G15230 116 / 3e-35 GAST1 protein homolog 4 (.1.2) Potri.001G254100 [exp] 107 / 2e-31 AT1G74670 111 / 4e-33 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.006G044400 [exp] 100 / 5e-29 AT1G74670 108 / 9e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.017G124200 [exp] 94 / 2e-26 AT3G02885 101 / 1e-29 GAST1 protein homolog 5 (.1) Potri.001G315500 [exp] 84 / 2e-22 AT2G30810 91 / 5e-25 Gibberellin-regulated family protein (.1) Potri.014G020100 [exp] 64 / 7e-15 AT5G59845 99 / 9e-29 Gibberellin-regulated family protein (.1) Potri.019G083900 [exp] 63 / 4e-14 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3) Potri.013G113400 [exp] 61 / 1e-13 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.009G092600 [exp] 59 / 1e-12 AT2G14900 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.001G297700 [exp] 58 / 2e-12 AT2G14900 96 / 2e-27 Gibberellin-regulated family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [flax] [poplar] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Lus10042203 pacid=23153576 polypeptide=Lus10042203 locus=Lus10042203.g ID=Lus10042203.BGIv1.0 annot-version=v1.0 ATGGCAATGGCTGCTAAGCAACTCGTCTGTCTATTGATCCTCGCGATTCTCGGCCTCTCCATGGTCGCCACTGAGGGGAAGGGGGGGAACTATGGACCTG GAAGTCTGAAGGGCTACCAATGCGGGGGGCAATGCACGAGGAGATGCAGCAGGACGCAGTACAGGAAGCCATGCTTGTTCTTCTGCAACAAATGCTGCGC AAAGTGTCTGTGTGTACCTCCTGGCTTCTACGGCAACAAGGCTGTTTGCCCTTGCTACAACAACTGGAAGACCCAGCAAGGAGGCCCCAAATGCCCTTAG
AA sequence Show only first row Show all	>Lus10042203 pacid=23153576 polypeptide=Lus10042203 locus=Lus10042203.g ID=Lus10042203.BGIv1.0 annot-version=v1.0 MAMAAKQLVCLLILAILGLSMVATEGKGGNYGPGSLKGYQCGGQCTRRCSRTQYRKPCLFFCNKCCAKCLCVPPGFYGNKAVCPCYNNWKTQQGGPKCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10042203 [exp]	0	1
AT1G11600		CYP77B1	"cytochrome P450, family 77, s...		Lus10018351 [exp]	3.9	0.8592
AT4G17150			alpha/beta-Hydrolases superfam...		Lus10039125 [exp]	4.9	0.8161
AT1G63260		TET10	tetraspanin10 (.1.2.3)		Lus10002230 [exp]	5.5	0.8435
AT3G18050			unknown protein		Lus10027253 [exp]	6.5	0.8188
AT3G43720			Bifunctional inhibitor/lipid-t...		Lus10001153 [exp]	10.2	0.8314
AT5G54980			Uncharacterised protein family...		Lus10021788 [exp]	10.3	0.7481
					Lus10015131 [exp]	11.3	0.8302
AT3G58100		PDCB5	plasmodesmata callose-binding ...		Lus10002193 [exp]	11.6	0.8156
AT1G28240			Protein of unknown function (D...		Lus10001446 [exp]	14.1	0.7850
AT4G02980		ABP1	endoplasmic reticulum auxin bi...		Lus10027985 [exp]	15.5	0.8078

Compare expression of checked genes

Lus10042203 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.