Lus10042208 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G53600 140 / 5e-39 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT2G35030 89 / 3e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G02750 86 / 4e-20 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G32415 82 / 9e-19 pentatricopeptide (PPR) repeat-containing protein (.1)
AT1G09410 81 / 3e-18 pentatricopeptide (PPR) repeat-containing protein (.1)
AT1G56690 81 / 4e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G29230 80 / 8e-18 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G16835 77 / 4e-17 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G62260 76 / 2e-16 MEF9 mitochondrial editing factor 9 (.1)
AT2G45350 73 / 1e-15 CRR4 CHLORORESPIRATORY REDUCTION 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008607 316 / 7e-108 AT1G53600 498 / 6e-171 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10013149 94 / 9e-23 AT1G56690 946 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10013540 89 / 8e-21 AT4G02750 1075 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030549 86 / 4e-20 AT4G02750 468 / 2e-154 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10012897 86 / 4e-20 AT4G02750 469 / 4e-156 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10017297 83 / 9e-20 AT4G02750 255 / 4e-80 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10012514 84 / 2e-19 AT1G62260 689 / 0.0 mitochondrial editing factor 9 (.1)
Lus10019797 83 / 7e-19 AT3G29230 768 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10027455 81 / 4e-18 AT3G29230 324 / 4e-102 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G048800 96 / 2e-23 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G019900 94 / 6e-23 AT4G02750 542 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.013G005400 93 / 2e-22 AT1G56690 1018 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.005G006400 93 / 2e-22 AT1G56690 993 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.009G139200 88 / 7e-21 AT1G62260 749 / 0.0 mitochondrial editing factor 9 (.1)
Potri.016G038400 88 / 1e-20 AT2G35030 701 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G087300 85 / 1e-19 AT1G32415 851 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Potri.017G086100 78 / 2e-17 AT5G15300 675 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.004G125500 77 / 6e-17 AT3G29230 829 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.003G116100 77 / 8e-17 AT4G22760 669 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10042208 pacid=23154030 polypeptide=Lus10042208 locus=Lus10042208.g ID=Lus10042208.BGIv1.0 annot-version=v1.0
ATGAAAGGGCTTGCTGTTCTCCCTCGCCACGTTTCCTTGTTGAAATGTTCAGTCTTCAGACGTTACTACTCGAAACCGGTTCAGAGGCGTGAACCCTATG
ACAAGTTAGTGGTTCACTGCAATTCCCAGATCACCAAGCATGGGAGAGAGGGCAGCATTCAGAATTCCGAGGAGATCTTCAGACGAATGTCTAGCAAGAC
CACTGTTTCTTACACTGCTATGCTCACCGCGTACTCTCAGAACAGCCAGTTCGCAAAGGCACGGAAGGTAATCGACAAGATGCCCTGCAGAACTACTGCT
TCCTACAATGCAATGATCACAGCCTATGTGAGAAATGGTTGTAAGGTGAACGAGGGCTTCAGTTTGTTTTCGCAGATGGATGAACGGAACGAGGTTACTT
TTGGTACCATGATCACAGGGTTCGTTAGGGTTGGGATGTTTGAAAGGGCTTGGGAGTTGTATGGGCAGATGCCCGGCTGA
AA sequence
>Lus10042208 pacid=23154030 polypeptide=Lus10042208 locus=Lus10042208.g ID=Lus10042208.BGIv1.0 annot-version=v1.0
MKGLAVLPRHVSLLKCSVFRRYYSKPVQRREPYDKLVVHCNSQITKHGREGSIQNSEEIFRRMSSKTTVSYTAMLTAYSQNSQFAKARKVIDKMPCRTTA
SYNAMITAYVRNGCKVNEGFSLFSQMDERNEVTFGTMITGFVRVGMFERAWELYGQMPG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G53600 Tetratricopeptide repeat (TPR)... Lus10042208 0 1
AT4G37560 Acetamidase/Formamidase family... Lus10011529 8.4 0.8110
AT1G60800 NIK3 NSP-interacting kinase 3 (.1) Lus10030591 22.8 0.7434
AT5G36930 Disease resistance protein (TI... Lus10023487 32.0 0.7734
AT1G60890 Phosphatidylinositol-4-phospha... Lus10001377 38.2 0.7509
AT1G09660 RNA-binding KH domain-containi... Lus10035768 45.8 0.7512
AT3G14205 Phosphoinositide phosphatase f... Lus10037446 48.8 0.7549
AT3G47780 ABCA7, ATATH6 A. THALIANA ABC2 HOMOLOG 6, AT... Lus10024243 57.2 0.7239
AT5G43710 Glycosyl hydrolase family 47 p... Lus10041170 65.2 0.7442
AT5G12100 pentatricopeptide (PPR) repeat... Lus10008650 82.0 0.7286
AT5G16000 NIK1 NSP-interacting kinase 1 (.1) Lus10034413 103.6 0.6674

Lus10042208 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.