Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59320 86 / 7e-23 LTP3 lipid transfer protein 3 (.1) AT2G38540 83 / 1e-21 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT3G51600 81 / 6e-21 LTP5 lipid transfer protein 5 (.1) AT5G59310 81 / 6e-21 LTP4 lipid transfer protein 4 (.1) AT2G38530 74 / 4e-18 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT5G01870 74 / 6e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G15050 73 / 1e-17 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT3G51590 70 / 2e-16 LTP12 lipid transfer protein 12 (.1) AT3G08770 68 / 8e-16 LTP6 lipid transfer protein 6 (.1.2) AT4G33355 66 / 6e-15 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008606 [exp] 225 / 5e-73 AT5G59320 84 / 3e-19 lipid transfer protein 3 (.1) Lus10009911 [exp] 115 / 3e-34 AT5G59320 72 / 4e-17 lipid transfer protein 3 (.1) Lus10022745 [exp] 93 / 2e-25 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10015279 [exp] 92 / 2e-25 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10014167 [exp] 90 / 3e-24 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10025151 [exp] 85 / 3e-22 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10024201 [exp] 84 / 3e-22 AT5G59320 57 / 5e-12 lipid transfer protein 3 (.1) Lus10025231 [exp] 81 / 7e-21 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1) Lus10029226 [exp] 79 / 4e-20 AT5G59310 94 / 3e-26 lipid transfer protein 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086500 [exp] 94 / 5e-26 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.004G086600 [exp] 92 / 2e-25 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135400 [exp] 81 / 1e-20 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.006G108100 [exp] 78 / 1e-19 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G136000 [exp] 72 / 2e-17 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 70 / 1e-16 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135500 [exp] 69 / 5e-16 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.001G232900 [exp] 64 / 5e-14 AT2G18370 100 / 3e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G232700 [exp] 64 / 5e-14 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G046500 [exp] 62 / 2e-13 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10042210 pacid=23153637 polypeptide=Lus10042210 locus=Lus10042210.g ID=Lus10042210.BGIv1.0 annot-version=v1.0 ATGGCTACTCTCTCCTTCCTAATCACCACATTACTGTTGGTCGCCATGGCCACCAACACCAATGCAGAAACCACGATAACCTGCGGTCAGGTGACCGCTC TCCTCACACCATGCATCCCTTACGGGGTCATGGGAGGTATCGTCCCACCGGGGTGTTGCTCCGGCCTCACACAGCTCGACACAGCAGAGAAGACCACCGA GGACAGACAAACTGCCTGCCGCTGTGTAGTCGATGGTGCTGCTGGGATACCTGGCCTCAACTACGACAGGGTGAATGAGCTTCCTGGGTTATGCAACACT ACTTGCCCCTATAAAGTTTACCCTGACACTGACTGCTCTAAGTACGCATATAATTACTAA
AA sequence Show only first row Show all	>Lus10042210 pacid=23153637 polypeptide=Lus10042210 locus=Lus10042210.g ID=Lus10042210.BGIv1.0 annot-version=v1.0 MATLSFLITTLLLVAMATNTNAETTITCGQVTALLTPCIPYGVMGGIVPPGCCSGLTQLDTAEKTTEDRQTACRCVVDGAAGIPGLNYDRVNELPGLCNT TCPYKVYPDTDCSKYAYNY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10042210 [exp]	0	1
AT4G31500		SUR2, RNT1, RED...	SUPERROOT 2, RUNT 1, RED ELONG...		Lus10034502 [exp]	1.0	0.9156
AT5G38960			RmlC-like cupins superfamily p...		Lus10006550 [exp]	2.0	0.8970
AT3G04200			RmlC-like cupins superfamily p...		Lus10006549 [exp]	4.2	0.8735
AT3G02100			UDP-Glycosyltransferase superf...		Lus10015746 [exp]	11.0	0.8650
AT3G50470		MLA10, HR3	INTRACELLULAR MILDEW A 10, hom...		Lus10009328 [exp]	11.6	0.8922
AT3G03530		NPC4	non-specific phospholipase C4 ...		Lus10028492 [exp]	11.7	0.8294
AT4G35160			O-methyltransferase family pro...		Lus10008538 [exp]	13.0	0.8929
AT2G44450		BGLU15	beta glucosidase 15 (.1)		Lus10031235 [exp]	13.3	0.8932
AT1G07250		UGT71C4	UDP-glucosyl transferase 71C4 ...		Lus10010476 [exp]	14.8	0.8141
					Lus10025503 [exp]	17.2	0.8586

Compare expression of checked genes

Lus10042210 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.