Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60870 495 / 4e-174 RUG3 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) AT5G16040 138 / 2e-36 Regulator of chromosome condensation (RCC1) family protein (.1) AT3G02510 137 / 4e-36 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) AT5G63860 124 / 7e-31 UVR8 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) AT5G12350 125 / 1e-30 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT1G65920 125 / 1e-30 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G42140 124 / 4e-30 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT5G19420 120 / 6e-29 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) AT1G76950 114 / 1e-26 PRAF1 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) AT4G14368 113 / 2e-26 Regulator of chromosome condensation (RCC1) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008601 [exp] 491 / 3e-174 AT5G60870 321 / 5e-108 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) Lus10008599 [exp] 319 / 6e-109 AT5G60870 231 / 2e-77 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) Lus10033543 [exp] 133 / 2e-34 AT3G02510 648 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10037192 [exp] 130 / 3e-32 AT1G69710 986 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Lus10017581 [exp] 127 / 3e-32 AT3G02510 636 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2) Lus10036737 [exp] 130 / 5e-32 AT1G69710 974 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Lus10036030 [exp] 125 / 1e-30 AT5G19420 1644 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10009701 [exp] 125 / 1e-30 AT5G19420 1567 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Lus10039618 [exp] 121 / 5e-30 AT5G63860 715 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G000600 [exp] 570 / 0 AT5G60870 534 / 0.0 RCC1/UVR8/GEF-like 3, Regulator of chromosome condensation (RCC1) family protein (.1), Regulator of chromosome condensation (RCC1) family protein (.2), Regulator of chromosome condensation (RCC1) family protein (.3) Potri.004G101800 [exp] 141 / 1e-37 AT5G16040 665 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.017G113200 [exp] 132 / 2e-34 AT5G16040 676 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Potri.001G276900 [exp] 127 / 3e-31 AT5G19420 1483 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.017G139600 [exp] 127 / 3e-31 AT1G65920 937 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Potri.007G100200 [exp] 124 / 5e-31 AT5G63860 738 / 0.0 UVB-RESISTANCE 8, Regulator of chromosome condensation (RCC1) family protein (.1) Potri.009G071800 [exp] 125 / 1e-30 AT5G19420 1610 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.004G080900 [exp] 124 / 4e-30 AT1G65920 940 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1) Potri.003G197600 [exp] 118 / 3e-28 AT5G19420 1292 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2) Potri.T124906 [exp] 118 / 3e-28 AT5G19420 1292 / 0.0 Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.1), Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00415 [flax] [poplar] RCC1 Regulator of chromosome condensation (RCC1) repeat
Representative CDS sequence Show only first row Show all	>Lus10042215 pacid=23153500 polypeptide=Lus10042215 locus=Lus10042215.g ID=Lus10042215.BGIv1.0 annot-version=v1.0 ATGATGTTTCTGCACCATCAACGGCATATTTTTTGTTCTAGGCCGCACATATCTTCCTGTTCCTCTTTTCTTAGAAGCATCCATGAGGTTCCCATTCTAT ACAAAAGCCCAGAACTCAGCAATGAAAATGAAAACCAGGGCAAACCTCTACAACTCCTGTCCTGGGGCAAAGGTGCCTCTGGCCAGCTTGGTGGTGGCAA CGAAGAAACCCGACTCTACCCTGCTGCTGTTGCAAACCTTCATGTCCTAAGTTCCTCCTTCACTTTTTCTCCAACCCCAGGACAGTTGCTTAAGTCTACA CTCAATAACCAAAATAACCTTAAGCAGAAGACTGAAGTTGGCATTTCCTGTGGGTTATTCCATTCAGCTTTGCTCGTGGATGGTAAGATTTGGATTTGGG GTAAAGGCGATGGTGGCCGTCTTGGCCTCGGGCACGAAAACATCGCTTTTGTTCCTACCCTTAACCCTTACTTGGATGACATTCGCTGCATTGCTTTGGG TGGAGTTCATTCGGTTGCGCTCACTTCCTCAGGTCAAATATTTACATGGGGCTATGGTGGTTTTGGCGCACTTGGACATTCTGTTTATCATCGAGAGTTA TTGCCCAGGTTGGTAGAAGGTATTTCGAATGTGAAAATGTCCTCTATCGCAACCAGTGGAACACATACTGCTGCTGTTACTGAGACAGGTGAGCTTTATA CATGGGGTCGTGATGAAGGGGATGGTAGACTGGGGCTTGGTCCTGGTCGGGGTCACAATGAAGCAGGTGGACTAAGCATCCCTTCCAAAGTTAGAGGTTT GCCTGTTCCAGTTTCTGCTGTTTGTTGTGGTGGGTTCTTCACGATGGCGCTCACACAGGATGGGAAAATATGGAATTGGGGTGCTAACTCAAACTATGAG CTTGGAAGAGGCAATAAGGTTGGGGGCTGGAAACCAGTCCCAATTCCTAGTCTTGAGGATGTCTGCATCACTCAGATAGCTTGTGGTGGATATCATTCAC TTGCATTGACTGATGAAGGCAAGGTCCTTTCATGGGGTTTCGGCGGGCATGGACAGCTTGGTCATTCATCATCGAAGGAAAACCAGAAAATCCCAGTAGT TATTGATGCCTTGGCTGATCAGCATGTCGTCCATATTGCTTGTGGAGGCTCTACTTCAGCGGCTATAACTGAGGAAGGGAAGCTTTATATGTGGGGAAAT AACCGAGATTTTCAGTTGGGAGTTGCTGGCTTACCTGAGGTGCAACCACTTCCAGTTGAGGTCAAGTTTCTGATGGAAGATGATGGGTTGGAACCTCACA AGTTACTCTCTGTCTCTGTTGGGGCTTCTCATGTTATGTGTTTGGCATTAAGGTCTGGTTGCTGA
AA sequence Show only first row Show all	>Lus10042215 pacid=23153500 polypeptide=Lus10042215 locus=Lus10042215.g ID=Lus10042215.BGIv1.0 annot-version=v1.0 MMFLHHQRHIFCSRPHISSCSSFLRSIHEVPILYKSPELSNENENQGKPLQLLSWGKGASGQLGGGNEETRLYPAAVANLHVLSSSFTFSPTPGQLLKST LNNQNNLKQKTEVGISCGLFHSALLVDGKIWIWGKGDGGRLGLGHENIAFVPTLNPYLDDIRCIALGGVHSVALTSSGQIFTWGYGGFGALGHSVYHREL LPRLVEGISNVKMSSIATSGTHTAAVTETGELYTWGRDEGDGRLGLGPGRGHNEAGGLSIPSKVRGLPVPVSAVCCGGFFTMALTQDGKIWNWGANSNYE LGRGNKVGGWKPVPIPSLEDVCITQIACGGYHSLALTDEGKVLSWGFGGHGQLGHSSSKENQKIPVVIDALADQHVVHIACGGSTSAAITEEGKLYMWGN NRDFQLGVAGLPEVQPLPVEVKFLMEDDGLEPHKLLSVSVGASHVMCLALRSGC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G60870		RUG3	RCC1/UVR8/GEF-like 3, Regulato...		Lus10042215 [exp]	0	1
AT2G38280		ATAMPD, FAC1	EMBRYONIC FACTOR1, ADENOSINE 5...		Lus10036700 [exp]	8.0	0.7739
AT1G06900			Insulinase (Peptidase family M...		Lus10042213 [exp]	8.4	0.7775
AT1G58280			Phosphoglycerate mutase family...		Lus10032821 [exp]	8.9	0.7557
AT5G05920		DHS, EDA22	embryo sac development arrest ...		Lus10029688 [exp]	10.2	0.7641
AT4G32910			unknown protein		Lus10011625 [exp]	13.6	0.7713
AT5G51540			Zincin-like metalloproteases f...		Lus10031715 [exp]	14.1	0.7577
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10027543 [exp]	14.5	0.7334
AT1G12930			ARM repeat superfamily protein...		Lus10012590 [exp]	16.7	0.7549
AT2G26790			Pentatricopeptide repeat (PPR)...		Lus10005692 [exp]	17.0	0.7397
AT1G78930			Mitochondrial transcription te...		Lus10037301 [exp]	18.7	0.6707

Compare expression of checked genes

Lus10042215 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.