Lus10042220 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G62680 100 / 3e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G06580 99 / 8e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G64100 96 / 1e-22 pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2)
AT5G16640 95 / 3e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G09900 95 / 4e-22 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
AT1G64583 94 / 4e-22 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G63230 91 / 2e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G28010 91 / 7e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G63130 91 / 7e-21 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G63080 91 / 9e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008593 230 / 5e-72 AT1G12700 400 / 7e-131 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10022861 196 / 4e-59 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10024962 184 / 9e-55 AT1G62680 346 / 3e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10009201 178 / 1e-54 AT1G12700 274 / 3e-86 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10003427 173 / 7e-52 AT1G12700 291 / 8e-92 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10020134 167 / 5e-50 AT1G12700 254 / 3e-78 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10014245 171 / 1e-49 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Lus10006218 164 / 3e-47 AT5G60230 251 / 4e-80 splicing endonuclease 2 (.1.2)
Lus10021074 161 / 3e-47 AT1G62930 273 / 5e-86 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G025600 140 / 3e-38 AT3G22470 426 / 3e-141 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.017G032100 135 / 2e-36 AT1G62930 451 / 2e-152 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.018G038300 131 / 7e-35 AT1G12700 490 / 8e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.013G149800 129 / 3e-34 AT1G12700 482 / 6e-162 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G271400 127 / 2e-33 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.019G021200 126 / 2e-33 AT1G12700 491 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.006G271200 125 / 9e-33 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G257300 123 / 4e-32 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G242200 122 / 7e-32 AT1G62930 472 / 4e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G242500 120 / 4e-31 AT1G62930 473 / 1e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10042220 pacid=23153707 polypeptide=Lus10042220 locus=Lus10042220.g ID=Lus10042220.BGIv1.0 annot-version=v1.0
ATGGCGAAGACAATCCTTTTACGTGGAAACGGCTCTCAATTTCAGCTCCTAAGGAAAGTGAGTATGCCTAACTTTTCATTTTCCTCATCGTCTTCAGCAT
TGTCAACAACGGCTCTATCCTCTCATTTCCGTTCCAACACTGCTACTCGTCCTACCACTAGTTCTACTCCTTTCACCACTGTTGAAGGCGCCTTGGATTC
ATTTAATCGGATGCTATGGATGAATCCCAGGCCTCATATCGCCGAGTTCGGTCAGTTATTCTTATTACTTGTGAAAATGAATGCGTATGGAGCTGCAGTT
TCGATGGGTGAAACCAGTGTTGGTCTTAAACTGCTTGAGAATATGGAAGATGGAGGAGGTTGGCCTCCGAATGTTGTTACTTACAATACGATCATGGATA
GCCTTTGTAAGGATGGGTTGGTGTCTGAAGCATTAGATGTTTTTCTCAGGATGAAGGATAGAAAATGTTTGCCGAATGTTATAAGTTACAATTGCTTGGC
TCATGGTTTATGTCTTTCGAGTCGGAGGAAAGAAGCAATGGCATTGTTGAATGAAATGTTAGAAATGAATGTCTTTCCTGACGTAGTCACTTATAACACT
CTGATCAACTACTTTTGCAAAGACGGAATGGTTCTAGAGGCCAAAGCTATAGTTAAACTGATTTTTCAGAATACTGCAACCGGATATCGTCACCTACAAT
TCATTGCTGGACGGGTATTGTTTGCGTAG
AA sequence
>Lus10042220 pacid=23153707 polypeptide=Lus10042220 locus=Lus10042220.g ID=Lus10042220.BGIv1.0 annot-version=v1.0
MAKTILLRGNGSQFQLLRKVSMPNFSFSSSSSALSTTALSSHFRSNTATRPTTSSTPFTTVEGALDSFNRMLWMNPRPHIAEFGQLFLLLVKMNAYGAAV
SMGETSVGLKLLENMEDGGGWPPNVVTYNTIMDSLCKDGLVSEALDVFLRMKDRKCLPNVISYNCLAHGLCLSSRRKEAMALLNEMLEMNVFPDVVTYNT
LINYFCKDGMVLEAKAIVKLIFQNTATGYRHLQFIAGRVLFA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G62680 Pentatricopeptide repeat (PPR)... Lus10042220 0 1
AT3G24560 RSY3 RASPBERRY 3, Adenine nucleotid... Lus10035028 1.7 0.8653
AT3G02600 ATLPP3, LPP3 lipid phosphate phosphatase 3 ... Lus10028489 2.8 0.8605
AT5G08490 SLG1 SLOW GROWTH 1, Tetratricopepti... Lus10014828 4.9 0.8473
AT5G11470 bromo-adjacent homology (BAH) ... Lus10038628 5.2 0.8533
AT1G01020 ARV1 Arv1-like protein (.1.2) Lus10007219 5.3 0.8139
AT5G59980 Polymerase/histidinol phosphat... Lus10042842 8.1 0.8170
AT5G18570 EMB3138, ATOBGL... EMBRYO DEFECTIVE 3138, EMBRYO ... Lus10006128 9.7 0.8333
AT1G67120 ATPases;nucleotide binding;ATP... Lus10037616 10.2 0.8119
AT1G55300 TAF7 TBP-associated factor 7 (.1.2) Lus10017011 11.2 0.8262
AT3G18380 SHH2 SAWADEE homeodomain homolog 2,... Lus10005480 11.6 0.8235

Lus10042220 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.