Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G33580 74 / 2e-17 Protein kinase superfamily protein (.1) AT1G51940 50 / 1e-08 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) AT3G21630 43 / 2e-06 LYSMRLK1, CERK1 LYSM DOMAIN RECEPTOR-LIKE KINASE 1, chitin elicitor receptor kinase 1 (.1) AT1G16150 39 / 7e-05 WAKL4 wall associated kinase-like 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008586 [exp] 129 / 1e-36 AT2G33580 594 / 0.0 Protein kinase superfamily protein (.1) Lus10042225 [exp] 85 / 2e-21 AT2G33580 209 / 5e-62 Protein kinase superfamily protein (.1) Lus10000577 [exp] 51 / 3e-09 AT2G23770 490 / 1e-166 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10019661 [exp] 49 / 2e-08 AT2G23770 483 / 8e-164 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10022489 [exp] 45 / 2e-07 AT2G33580 87 / 9e-21 Protein kinase superfamily protein (.1) Lus10006841 [exp] 44 / 1e-06 AT1G51940 812 / 0.0 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10037586 [exp] 44 / 1e-06 AT1G51940 807 / 0.0 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Lus10022487 [exp] 40 / 2e-05 AT5G66631 707 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10004625 [exp] 40 / 2e-05 AT1G51940 347 / 7e-111 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G259600 [exp] 94 / 2e-24 AT2G33580 637 / 0.0 Protein kinase superfamily protein (.1) Potri.001G190200 [exp] 50 / 7e-09 AT1G51940 824 / 0.0 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.015G081601 [exp] 44 / 9e-07 AT1G51940 337 / 5e-107 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.T125208 [exp] 44 / 1e-06 AT1G51940 336 / 9e-107 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.011G010000 [exp] 44 / 1e-06 AT3G21630 673 / 0.0 LYSM DOMAIN RECEPTOR-LIKE KINASE 1, chitin elicitor receptor kinase 1 (.1) Potri.008G187500 [exp] 40 / 3e-05 AT1G51940 362 / 7e-117 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.006G252600 [exp] 39 / 7e-05 AT1G51940 326 / 4e-103 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.014G156400 [exp] 38 / 0.0002 AT3G21630 678 / 0.0 LYSM DOMAIN RECEPTOR-LIKE KINASE 1, chitin elicitor receptor kinase 1 (.1) Potri.002G226600 [exp] 38 / 0.0002 AT3G21630 697 / 0.0 LYSM DOMAIN RECEPTOR-LIKE KINASE 1, chitin elicitor receptor kinase 1 (.1) Potri.015G085400 [exp] 37 / 0.0004 AT2G33580 163 / 4e-46 Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042226 pacid=23153718 polypeptide=Lus10042226 locus=Lus10042226.g ID=Lus10042226.BGIv1.0 annot-version=v1.0 ATGGAGGACGAATACTCGTTAGATCTTGCCTTCTCCCTGGCTCAGCTTGCAAAAGGGTGCGTTTCTCGAGACCTCAACGCTCGACCTGGCATGCCCCAGG TTTTGATGACTTTGTCCAAGATACTGTCCTCTTCGCTGGACTGGGATCCTTCTGATGAGGTTCAGACATCCTCTGCTTCTAATTCTGTCAGTCAAGGGAG GTAG
AA sequence Show only first row Show all	>Lus10042226 pacid=23153718 polypeptide=Lus10042226 locus=Lus10042226.g ID=Lus10042226.BGIv1.0 annot-version=v1.0 MEDEYSLDLAFSLAQLAKGCVSRDLNARPGMPQVLMTLSKILSSSLDWDPSDEVQTSSASNSVSQGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G33580			Protein kinase superfamily pro...		Lus10042226 [exp]	0	1
AT4G17500	AP2_ERF	ATERF-1, AtERF1	ethylene responsive element bi...		Lus10004368 [exp]	2.2	0.8831
AT5G47850		CCR4	CRINKLY4 related 4 (.1)		Lus10012995 [exp]	2.2	0.8325
AT1G34300			lectin protein kinase family p...		Lus10013252 [exp]	4.5	0.8542
AT1G20510		OPCL1	OPC-8:0 CoA ligase1 (.1.2)		Lus10015998 [exp]	5.2	0.8426
AT4G17500	AP2_ERF	ATERF-1, AtERF1	ethylene responsive element bi...		Lus10040165 [exp]	5.3	0.8412
AT4G25030			unknown protein		Lus10041415 [exp]	9.2	0.8214
AT3G17980		AtC2	Arabidopsis thaliana C2 domain...		Lus10033585 [exp]	9.7	0.7735
AT5G19980		GONST4	golgi nucleotide sugar transpo...		Lus10017141 [exp]	11.7	0.8208
AT3G55430			O-Glycosyl hydrolases family 1...		Lus10040294 [exp]	14.7	0.8224
AT4G08850			Leucine-rich repeat receptor-l...		Lus10020936 [exp]	15.5	0.7490

Compare expression of checked genes

Lus10042226 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.