Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G58375 70 / 2e-17 Methyltransferase-related protein (.1) AT5G14602 59 / 5e-13 unknown protein AT5G18150 57 / 2e-12 Methyltransferase-related protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008585 [exp] 124 / 1e-38 AT5G58375 89 / 1e-24 Methyltransferase-related protein (.1) Lus10020287 [exp] 61 / 8e-14 AT5G18150 109 / 4e-33 Methyltransferase-related protein (.1) Lus10005698 [exp] 61 / 8e-14 AT5G18150 108 / 1e-32 Methyltransferase-related protein (.1) Lus10034423 [exp] 56 / 1e-11 AT5G18150 87 / 5e-24 Methyltransferase-related protein (.1) Lus10019138 [exp] 53 / 2e-10 AT5G18150 80 / 3e-21 Methyltransferase-related protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G155800 [exp] 66 / 1e-15 AT5G58375 67 / 5e-16 Methyltransferase-related protein (.1) Potri.019G127900 [exp] 64 / 5e-15 AT5G58375 64 / 6e-15 Methyltransferase-related protein (.1) Potri.013G058200 [exp] 62 / 5e-14 AT5G18150 114 / 5e-35 Methyltransferase-related protein (.1) Potri.019G035000 [exp] 60 / 2e-13 AT5G18150 109 / 4e-33 Methyltransferase-related protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10042227 pacid=23153525 polypeptide=Lus10042227 locus=Lus10042227.g ID=Lus10042227.BGIv1.0 annot-version=v1.0 ATGTGCCCTCTCCGCATCATTCTCGTCTTCCTCTCCGCCACTCTCGCCGGCTTCTTCCTCTTCCGCAACCTCAACTCTCAAACCCCTCTCTCCGACGATC ACCGAGACTCCTCTTCAGCTGAATCCTCCTCATCCTCCTCCACTAGTCGATTGTCCAAGCTCCGGTCAGCTGTGGAGTCCGGGTTCTGGACCGGCGTTGA CATGGCCAGTGGACGCTACCTCTGGAGACATTTGACGGCTGCTTCTTCGTCTACTCCAGAAGCTCGTGATCCATCTGATTAG
AA sequence Show only first row Show all	>Lus10042227 pacid=23153525 polypeptide=Lus10042227 locus=Lus10042227.g ID=Lus10042227.BGIv1.0 annot-version=v1.0 MCPLRIILVFLSATLAGFFLFRNLNSQTPLSDDHRDSSSAESSSSSSTSRLSKLRSAVESGFWTGVDMASGRYLWRHLTAASSSTPEARDPSD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G58375			Methyltransferase-related prot...		Lus10042227 [exp]	0	1
AT3G48560		TZP5, IMR1, ALS...	TRIAZOLOPYRIMIDINE RESISTANT 5...		Lus10029955 [exp]	2.0	0.8773
AT5G13420			Aldolase-type TIM barrel famil...		Lus10043136 [exp]	2.6	0.9119
AT2G46620			P-loop containing nucleoside t...		Lus10005991 [exp]	3.0	0.8701
AT1G07890		ATAPX01, CS1, A...	maternal effect embryo arrest ...		Lus10015970 [exp]	3.5	0.8728
AT2G19570		DESZ, AT-CDA1, ...	cytidine deaminase 1 (.1)		Lus10007654 [exp]	3.9	0.8837
AT4G21350		PUB8, B80	plant U-box 8 (.1)		Lus10006747 [exp]	5.7	0.8713
AT1G52330			Late embryogenesis abundant (L...		Lus10011458 [exp]	5.7	0.8866
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10022193 [exp]	7.7	0.8640
AT5G10530			Concanavalin A-like lectin pro...		Lus10029554 [exp]	7.9	0.8332
AT1G07940			GTP binding Elongation factor ...		Lus10023497 [exp]	9.2	0.8577

Compare expression of checked genes

Lus10042227 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.